SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_3B_68BFA25F1.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_3B_68BFA25F1.1
Domain Number 1 Region: 166-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-29
Family B3 DNA binding domain 0.0000142
Further Details:      
 
Domain Number 2 Region: 55-112
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000353
Family GCC-box binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_3B_68BFA25F1.1
Sequence length 350
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_3B_scaff_10661426:2279:3751:1 gene:Traes_3B_68BFA25F1 transcript:Traes_3B_68BFA25F1.1 description:""
Sequence
MGVEILSSMVEHSFQYSSGVSTATTESGTAGTPPRPLSLPVAIADESVTSRSASSRFKGV
VPQPNGRWGAQIYERHARVWLGTFPDQDSAARAYDVASLRYRGRDVAFNFPCAAVEGELA
FLAAHSKAEIVDMLRKQTYADELRQGLRRGRGMGARAQPTPSWAREPLFEKAVTPSDVGK
LNRLVVPKQHAEKHFPLKRTPETPTTTGKGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTK
GWSRFVREKGLGAGDSILFSCSLYEQEKQFFIDCKKNTSMNGGKSASPLPVGVTTKGEQV
RVVRLFGVDISGVKRGRAATATAEQGLQELFKRQCVAPGQHSPALGAFAL
Download sequence
Identical sequences W5CWS4
Traes_3B_68BFA25F1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]