SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_4AS_9C1CB8D5A.2 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4AS_9C1CB8D5A.2
Domain Number 1 Region: 636-827
Classification Level Classification E-value
Superfamily Sec7 domain 8.24e-78
Family Sec7 domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 95-128,418-574,908-981,1147-1405,1434-1516
Classification Level Classification E-value
Superfamily ARM repeat 1.08e-18
Family Armadillo repeat 0.044
Further Details:      
 
Weak hits

Sequence:  Traes_4AS_9C1CB8D5A.2
Domain Number - Region: 19-65,95-185
Classification Level Classification E-value
Superfamily ARM repeat 0.0702
Family Armadillo repeat 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_4AS_9C1CB8D5A.2
Sequence length 1788
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4AS_scaff_5974854:1650:12457:-1 gene:Traes_4AS_9C1CB8D5A transcript:Traes_4AS_9C1CB8D5A.2 description:""
Sequence
MASAAAAAPPPLSSPESDPRLVEAFVPFLEKLVKNASWRNKAHSKLSHTAKSILDRLQRP
PPPSPTAAQTPSTPTSPSTPTSSSWQPGPLRNLSLEDSELLLSPISSALGSGSAKLVEAA
LELLHRLIAHSYIHGEADPSADPSSQLVASLLEAACNALHLDDEHIELLLLKTLLSAVTS
TSVCLHGDCLLRAVRACYDMYLGSRSTVNQATAKASLVQMLVIVFRRMEADSSTIPVQPI
VVAEVIELPDAGSGASPTADVTFVQGFISKIMVDIDGAFTPLARTTSSAAAGTVPHDGAF
ETTAAAEEGANPADLLDSTDKDMLDAKYWEISMYKTALEGRKDELGVEGAVVATLDDDAD
VRIGNKLRRDAFLVFRALCKLSMKTPPKDAPADPIVMRGKILALELLKILLENAGAVFRT
SERFLGAIKQYLCLSLLKNCASSHMIVFQLSCSIFISLVSRFRPGLKAEIGVFFPMIILR
VLENIAQPNFQAKMIVLRFLEKLCTDSQILVDIFINYDCDVHSSNIFERMVNGLLKTAQG
PPAGIATTLVPPQDTTMKSEAMKCLVSILRSMGDWMNKQLSIPDPDSPKIESEQNDNDGG
NEFPQTEINGDASSEVSDSHSEVSNGVSEAASLEQRRAYKMELQEGIALFNRKPRKGIEF
LINANKVGESAEDIAAFLKSTSGLNKTMIGDYLGEREDLSLKVMHAYVDSFNFQNMEFDE
AIRAFLQGFRLPGEAQKIDRVMEKFAERYCKCNPKAFSSADTAYVLAYSVIMLNTDAHNP
MVKNKMSPEDFIRNNRGIDDGKDLPEEFMRSLYGRIWKKEIKMKEDEFVPHQQQSTSSNK
ILGLDNILNIVIRKRGSAMETSDDLIKHMQEQFKEKARMSESIFYPATDVVILKFMVEVC
WAPMLAAFSVPLDQSDDEIVISQCLEGFRCAIHVTAAMSMKTQRDAFITSLAKFTSLHSA
ADIKQKNIEAIKAILLIADEDGNYLQEAWEHILTCVSRFENLHLVGEGAPPDATFFALQQ
PDLDKSKQAKSSIIPGLKKKAPTAGAASKRGTYDSAGVGGKASGVDQMNNAVTILLEQVG
MAEMNRVFIRSQNLNSEGIIDFVKALCKVSMEELRSASDPRVFSLTKIVEITHYNMNRIR
LVWSSIWHVLSEFFVTIGCSENLSIAIFAMDSLRQLAMKFLEREELANYNFQNEFMKPFV
VVMRKSRAVEIRELIIRCVSQMVLARVNHVKSGWKSMFMVFATASYDDHKNIVLLAFEII
EKILRDYFPYITETESSTFTDCVNCLIAFTNSRFNKDISLNAIGFLRFCAAKLAEGDIGS
SSRLKEPSPRLTKDGKQEGAIQVDKDDHIHFWFPLLAGLSELTFDLRPEIRKSSLQVLFD
TLRNHGHVFSLPLWEKVFDSVLFPIFDYVWHAIDPSGGSSQGQNAENDPAELDQDAWMYE
TCTLALQLVVDLFVKFYDTVHPLLRKVLSLLTSFIKRPHQSLAGIGIAAFVRLMSSAGSV
FVDEKWLEVVLSLKEATTETLPDFSYIASGAYLENVPIENGDSSDKREDESQPSEDGTEE
TSRSRNLYFAIADAKCRAAVQLLLIQAVMEIYNMYRAQLSAQNTVILFEALHTVATHAHK
INSDNDLRTKLQELGSMTQMQDPPLLRLENESYQLCLTILQNIFLDRAPDEGSLEVETHL
VGLCKEVLEVYLSTARPAHLSGGIQPLGHWLIPVGSSKRRELAARAPLVVSTLQAISGLG
DSSFEKNLGQFFPLLAGLISCEHGSGEVQVALSDMFSTWVGPIVLQSC
Download sequence
Identical sequences W5DYV0
Traes_4AS_9C1CB8D5A.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]