SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_4BL_2909317CC.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4BL_2909317CC.1
Domain Number 1 Region: 437-628
Classification Level Classification E-value
Superfamily Sec7 domain 7.06e-78
Family Sec7 domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 202-375,709-782,948-1206,1235-1312
Classification Level Classification E-value
Superfamily ARM repeat 9.05e-21
Family Armadillo repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_4BL_2909317CC.1
Sequence length 1589
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4BL_scaff_6980783:6969:15148:-1 gene:Traes_4BL_2909317CC transcript:Traes_4BL_2909317CC.1 description:""
Sequence
MYLGSRSTVNQATAKASLVQMLVIVFRRMEADSSTIPVQPIVVAEVIELPDAGSGASPTA
DATFVQGFISKIIGDIDGALTPLTRTTSSAAAGTVPHDGAFETTAAAEEGANPADLLDST
DKDMLDAKYWEISMYKTALEGRKDELGVEGAVVATLDDDADFRIGNKLRRDAFLVFRALC
KLSMKTPPKDAPADPIVMRGKILALELLKILLENAGAVFRTSERFLGAIKQYLCLSLLKN
CASSHMIVFQLSCSIFISLVSRFRPGLKAEIGVFFPMIILRVLENIAQPNFQAKMIVLRF
LEKLCTDSQILVDIFINYDCDVHSSNIFERMVNGLLKTAQGPPAGIATTLVPPQDTTMKS
EAMKCLVSILRSMGDWMNKQLRIPDPDSPKIESEQNDNDGGNEFPQTDINGDASSEVSDS
HSEVSNGVSEAASLEQRRAYKMELQEGIALFNRKPRKGIEFLINANKVGESAEDIAAFLK
STSGLNKTMIGDYLGEREDLSLKVMHAYVDSFNFQNMEFDEAIRAFLQGFRLPGEAQKID
RVMEKFAERYCKCNPKAFSSADTAYVLAYSVIMLNTDAHNPMVKNKMSPEDFIRNNRGID
DGKDLPEEFMRSLYGRIWKKEIKMKEDEFVPHQQQSTSSNKILGLDNILNIVIRKRGSAM
ETSDDLIKHMQEQFKEKARMSESVFYPATDVVILKFMVEVCWAPMLAAFSVPLDQSDDEI
VISQCLEGFRCAIHVTAAMSMKTQRDAFITSLAKFTSLHSAADIKQKNIEAIKAILLIAD
EDGNYLQEAWEHILTCVSRFENLHLVGEGAPPDATFFALQQPDLDKSKQAKSSIIPGLKK
KAPNAGAASKRGTYDSAGVGGKASGVDQMNNAVTILLEQVGMAEMNRVFIRSQNLNSEGI
IDFVKALCKVSMEELRSASDPRVFSLTKIVEITHYNMNRIRLVWSSIWHVLSEFFVTIGC
SENLSIAIFAMDSLRQLAMKFLEREELANYNFQNEFMKPFVVVMRKSRAVEIRELIIRCV
SQMVLARVNHVKSGWKSMFMVFATASYDDHKNIVLLAFEIIEKILRDYFPYITETESSTF
TDCVNCLIAFTNSRFNKDIGLNAIGFLRFCAAKLAEGDIGSSSRLKEPSPHLTKDGKQEG
AIQVDKDDHIHFWFPLLAGLSELTFDLRPEIRKSSLQVLFDTLRNHGHVFSLPLWEKVFD
SVLFPIFDYVRHAIDPSGGSSQGQNAENDPAELDQDAWMYETCTLALQLVVDLFVKFYDT
VHPLLKKVLSLLTSFIKRPHQSLAGIGIAAFVRLMSSAGSVFVDEKWLEVVLSLKEVTTE
TLPDFSYIASGAYLESVPIENGDSSDKREHESQPSEDGTEETSRSRNLYFAIADAKCRAA
VQLLLIQAVMEIYNMYRAQLSAQNTVILFEALHTVATHAHKINSDNDLRTKLQELGSMTQ
MQDPPLLRLENESYQLCLTILQNIFLDRAPDEGSLEVETHLVGLCKEVLEVYLSTARPAH
LSGGIQPLGHWFIPVGSSKRRELAARAPLVVSTLQAISGLGDSSFEKNLGQFFPLLAGLI
SCEHGSGEVQVALSDMFSTWVGPIVLQSC
Download sequence
Identical sequences Traes_4BL_2909317CC.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]