SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_4DL_D3D9833F3.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_4DL_D3D9833F3.1
Domain Number 1 Region: 332-523
Classification Level Classification E-value
Superfamily Sec7 domain 9.94e-78
Family Sec7 domain 0.00000157
Further Details:      
 
Domain Number 2 Region: 97-270,604-677,843-1101,1130-1212
Classification Level Classification E-value
Superfamily ARM repeat 9.98e-21
Family Armadillo repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Traes_4DL_D3D9833F3.1
Sequence length 1484
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_4DL_scaff_14340735:1:8534:1 gene:Traes_4DL_D3D9833F3 transcript:Traes_4DL_D3D9833F3.1 description:""
Sequence
MLDAKYWEISMYKTALEGRKDELGVEGAVVAXKYNCIINQIGVEGAVVATLDDDADVRIG
NKLRRDAFLVFRALCKLSMKTPPKDAPADPIVMRGKILALELLKILLENAGAVFRTSERF
LGAIKQYLCLSLLKNCASSHMIVFQLSCSIFISLVSRFRPGLKAEIGVFFPMIILRVLEN
IAQPNFQAKMIVLRFLEKLCTDSQILVDIFINYDCDVHSSNIFERMVNGLLKTAQGPPAG
IATTLVPPQDTTMKSEAMKCLVSILRSMGDWMNKQLRIPDPDSPKIESEQNDNDGGNEFP
QTEINGDASSEVSDSHSEVSNGVSEAASLEQRRAYKMELQEGIALFNRKPRKGIEFLINA
NKVGESSEDIAAFLKSTSGLNKTMIGDYLGEREDLSLKVMHAYVDSFNFQNMEFDEAIRA
FLQGFRLPGEAQKIDRVMEKFAERYCKCNPKAFSSADTAYVLAYSVIMLNTDAHNPMVKN
KMSPEDFIRNNRGIDDGKDLPEEFMRSLYGRIWKKEIKMKEDEFVPHQQQSTSSNKILGL
DNILNIVIRKRGSAMETSDDLIKHMQEQFKEKARMSESVFYPATDVVILKFMVEVCWAPM
LAAFSVPLDQSDDEIVISQCLEGFRCAIHVTAAMSMKTQRDAFITSLAKFTSLHSAADIK
QKNIEAIKAILLIADEDGNYLQEAWEHILTCVSRFENLHLVGEGAPPDATFFALQQPDLD
KSKQAKSSIIPGLKKKAPNAGAASKRGTYDSAGVGGKASGVDQMNNAVTILLEQVGIAEM
NRVFIRSQNLNSEGIIDFVKALCKVSMEELRSASDPRVFSLTKIVEITHYNMNRIRLVWS
SIWHVLSEFFVTIGCSENLSIAIFAMDSLRQLAMKFLEREELANYNFQNEFMKPFVVVMR
KSRAVEIRELIIRCVSQMVLARVNHVKSGWKSMFMVFATASYDDHKNIVLLAFEIIEKIL
RDYFPYITETESSTFTDCVNCLIAFTNSRFNKDISLNAIGFLRFCAAKLAEGDIGSSSRL
KEPSPRLTKDGKQEGAIQVDKDDHIHFWFPLLAGLSELTFDLRPEIRKSSLQVLFDTLRN
HGHVFSLPLWEKVFDSVLFPIFDYVRHAIDPSGGSSQGQSAENDPAELDQDAWMYETCTL
ALQLVVDLFVKFYDTVHPLLKKVLSLLTSFIKRPHQSLAGIGIAAFVRLMSSAGSVFVDE
KWLEVVLSLKEATTETLPDFSYIASGAYLENVPIENGDSSDKREDESQPSEDGTEETSRS
RNLYFAIADAKCRAAVQLLLIQAVMEIYNMYRAQLSAQNTVILFEALHTVATHAHKINSD
NDLRTKLQELGSMTQMQDPPLLRLENESYQLCLTILQNIFLDRAPDEGSLEVETHLVGLC
KEVLEVYLSTARPAHLSGGIQPLGHWLIPVGSSKRRELAARAPLVVSTLQAISGLGDSSF
EKNLGQFFPLLAGLISCEHGSGEVQVALSDMFSTWVGPIVLQSC
Download sequence
Identical sequences Traes_4DL_D3D9833F3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]