SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_5DL_B9F88A734.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_5DL_B9F88A734.1
Domain Number 1 Region: 265-342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.55e-19
Family Protein kinases, catalytic subunit 0.0032
Further Details:      
 
Domain Number 2 Region: 149-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  Traes_5DL_B9F88A734.1
Domain Number - Region: 117-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.086
Family EGF-like domain of nidogen-1 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_5DL_B9F88A734.1
Sequence length 347
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5DL_scaff_4467174:3:1318:1 gene:Traes_5DL_B9F88A734 transcript:Traes_5DL_B9F88A734.1 description:""
Sequence
MSVCRPSERALPGSCRGGDGCCQSNIPLGLASYRPHVRSFGRRQQQQGGTFLANSTGCAY
AFMVDAWWFWYAGSHFNRTGDFAVPVVLDWAIRGAGAGGSCATVRENATAYACRSAHSVC
LDSSNGPGYVCNCTSGYEGNPYVLGGCNDVDECAEHDLYPCYGVCTNTPGSYLCTCPKGW
SGNATVQDGCHQQDKFTLALKAVTGVSIGVFMVILACFWAHLSLQKRRMLRAKQRFFEQN
GGLLLQQHLGSLASSGVAFKIFSEEEIKKATGNFDEAQVLGRGGNGVVYRGVLPGAGGST
TVAIKRSRVADEKQLKEFSKEMLILSQINHRNVVKLLGCCLEVEVPM
Download sequence
Identical sequences Traes_5DL_B9F88A734.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]