SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_5DS_2873CCD2F.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_5DS_2873CCD2F.1
Domain Number 1 Region: 107-218
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.000000000000354
Family Plant cytotoxins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Traes_5DS_2873CCD2F.1
Sequence length 374
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_5DS_scaff_2775851:2248:3855:1 gene:Traes_5DS_2873CCD2F transcript:Traes_5DS_2873CCD2F.1 description:""
Sequence
MAWAPSCSCTTGMMMATRFSRCAPPAMGARRTSPTTVHLRPSPASPTSWSKTAVGDRALV
STTTKRRTVPPACNNKPGPSGQAPTSKKDLSFDINLTAEDDDHFKKNFLEPMRDRLSDPE
GPTVDILDPDSGNVVHIPRLPPQVRDNPAPELMNLTLHLGEEARVTLSVQTDNLYVVGFR
NGEGKAFEFTHYNPDGTPREGYRMIPGSTNLGYSGSYAGGNGMGGLSQQQVVLLDSGNRF
FNSNVYGRVNATTKLASGEELPYTLLSKQANQSHTTRHHESVPLQRNLISAQLGAELHIS
ADLWDYNKLVFSDDQIVVGSVVFVPRHAGTTDKADINGPCGKVRVEVTWSTSYSYKSMKD
EEPKSSPPFIHDDL
Download sequence
Identical sequences W5G1R9
Traes_5DS_2873CCD2F.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]