SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_6AS_70AD4B0D5.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_6AS_70AD4B0D5.1
Domain Number 1 Region: 160-239
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000015
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 269-299
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000406
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 97-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000222
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 33-58
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000144
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_6AS_70AD4B0D5.1
Sequence length 304
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_6AS_scaff_4350221:62:3904:-1 gene:Traes_6AS_70AD4B0D5 transcript:Traes_6AS_70AD4B0D5.1 description:""
Sequence
MEGGGRKRGTADGAAVGGKRTRESESFQTGVGSKSKPCTKFFSTAGCPFGEGCHFLHYFP
GGHQAVAKMSNLGGQAFAHPQGRMPSGSAVPDGHPTPTVKTKLCNKYNTAEGCKWGDKCH
FAHGERELGKQTFINNSMPPHMGPRPTGHFGPPAMPSPGMATPAGFGASSTAKVSVDASL
AGAIIGRGGVNTKQISRVTGAKLAIRDHESNEALKNIELEGTFDQINNASAMLRELIFRI
SGGANAPPPGVIPAGGSHRGGGGSGQGSNFKTKLCDNFTKGSCTFGDRCHFAHGENELRK
SAAV
Download sequence
Identical sequences W5GE74
Traes_6AS_70AD4B0D5.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]