SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Traes_7DL_BC8BA3B78.1 from Triticum aestivum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Traes_7DL_BC8BA3B78.1
Domain Number 1 Region: 175-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.99e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 267-297
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000628
Family CCCH zinc finger 0.0017
Further Details:      
 
Domain Number 3 Region: 101-133
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000432
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 37-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000301
Family CCCH zinc finger 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Traes_7DL_BC8BA3B78.1
Sequence length 302
Comment pep:novel scaffold:IWGSP1:IWGSC_CSS_7DL_scaff_3374452:556:3446:1 gene:Traes_7DL_BC8BA3B78 transcript:Traes_7DL_BC8BA3B78.1 description:""
Sequence
MFSYKCQDFSKINTVLTGGSNKFGVAESESVQTGVGSKSKPCTKFFSTAGCPFGSSCHFL
HNFPGGHQAVSKMTNLGGPAVSAPQGRMPMGPGVPDGPPTPSLKTRLCNKFNTAEGCKWG
NKCHFAHGERELGKPMLLNNSMAPPMGPRPNGHFQPPPMPGPDMVPPSTFGASATAKISV
DASLAGAIIGKGGVNTKHISRMTGAKLAIRDNEADPNHKNIELEGSFDQVNHASAMVKEL
ILRIGGNAPPQAKNPGRGPAGGGGGSNFKTKLCDNFNKGSCTFGDRCHFAHGESELRKSA
AA
Download sequence
Identical sequences Traes_7DL_BC8BA3B78.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]