SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397664423|ref|YP_006505961.1| from Legionella pneumophila subsp. pneumophila

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397664423|ref|YP_006505961.1|
Domain Number 1 Region: 198-353
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 6.02e-76
Family RalF, C-terminal domain 0.0000000897
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily Sec7 domain 4.06e-60
Family Sec7 domain 0.0000000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397664423|ref|YP_006505961.1|
Sequence length 398
Comment RalF protein, translocated into host cells by the Dot/Icm system [Legionella pneumophila subsp. pneumophila]
Sequence
MHPEIEKAQREITEAFNAKPKNGIEKIKEICEEYKISAHEEIAAFFHQQRKNLDLEAVGD
YLSGPEAENQQVLKAFTSQMDFTGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYSQ
QNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTMDGLKRNLRGGNNGGDFDAKFL
EELYSEIKAKPFELNFVKTSPGYELNSTTLNKDSTFKNLDSFLHSKDVNINTVFPGIGDN
VKTTVDQPKSWLSFFTGYKGTITLTDKQTSAQATIQVYTPNILSKWLFGEQPRVIIQPGQ
TKESIDLAAKVAAGFSSPVKNFKATYDYEVGDLIKAYDNQKKLVSTNKNTVIKGSIFRTP
NAEQQETSKSATRTLNTDYDINEDTVTRNDESRSSYKK
Download sequence
Identical sequences A0A130PVT9
gi|397664423|ref|YP_006505961.1| WP_014841997.1.101751 WP_014841997.1.101869 WP_014841997.1.10234 WP_014841997.1.11317 WP_014841997.1.13961 WP_014841997.1.14270 WP_014841997.1.14396 WP_014841997.1.16601 WP_014841997.1.17351 WP_014841997.1.18568 WP_014841997.1.19186 WP_014841997.1.20993 WP_014841997.1.22039 WP_014841997.1.2239 WP_014841997.1.2394 WP_014841997.1.24790 WP_014841997.1.2526 WP_014841997.1.27354 WP_014841997.1.28020 WP_014841997.1.28346 WP_014841997.1.30513 WP_014841997.1.30717 WP_014841997.1.31862 WP_014841997.1.3365 WP_014841997.1.34228 WP_014841997.1.36556 WP_014841997.1.36852 WP_014841997.1.38174 WP_014841997.1.38634 WP_014841997.1.38919 WP_014841997.1.3933 WP_014841997.1.40375 WP_014841997.1.41061 WP_014841997.1.41194 WP_014841997.1.42405 WP_014841997.1.44696 WP_014841997.1.47341 WP_014841997.1.48881 WP_014841997.1.50772 WP_014841997.1.51257 WP_014841997.1.51685 WP_014841997.1.51958 WP_014841997.1.5268 WP_014841997.1.52723 WP_014841997.1.52787 WP_014841997.1.53602 WP_014841997.1.54704 WP_014841997.1.54834 WP_014841997.1.5660 WP_014841997.1.57482 WP_014841997.1.58658 WP_014841997.1.58764 WP_014841997.1.60120 WP_014841997.1.61227 WP_014841997.1.64049 WP_014841997.1.64298 WP_014841997.1.66058 WP_014841997.1.67448 WP_014841997.1.67763 WP_014841997.1.69332 WP_014841997.1.70654 WP_014841997.1.7066 WP_014841997.1.70860 WP_014841997.1.72375 WP_014841997.1.74003 WP_014841997.1.74371 WP_014841997.1.74412 WP_014841997.1.7452 WP_014841997.1.75242 WP_014841997.1.7619 WP_014841997.1.78342 WP_014841997.1.79998 WP_014841997.1.80041 WP_014841997.1.80459 WP_014841997.1.81762 WP_014841997.1.83017 WP_014841997.1.83062 WP_014841997.1.83658 WP_014841997.1.84341 WP_014841997.1.85643 WP_014841997.1.86050 WP_014841997.1.87014 WP_014841997.1.87431 WP_014841997.1.87917 WP_014841997.1.88023 WP_014841997.1.88271 WP_014841997.1.88601 WP_014841997.1.90915 WP_014841997.1.92683 WP_014841997.1.93993 WP_014841997.1.94044 WP_014841997.1.9449 WP_014841997.1.96522 WP_014841997.1.97638 WP_014841997.1.97957 WP_014841997.1.9807 WP_014841997.1.98134 WP_014841997.1.98839 WP_014841997.1.99514 WP_014841997.1.99870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]