SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470478195|ref|YP_007638939.1| from Psychromonas sp. CNPT3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470478195|ref|YP_007638939.1|
Domain Number 1 Region: 20-133
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 4.18e-25
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00057
Further Details:      
 
Domain Number 2 Region: 489-591
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-17
Family Thioltransferase 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|470478195|ref|YP_007638939.1|
Domain Number - Region: 164-446
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00759
Family LacY-like proton/sugar symporter 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470478195|ref|YP_007638939.1|
Sequence length 596
Comment Thiol:disulfide interchange protein dsbD 1 precursor (Protein-disulfide reductase 1) (Disulfide reductase 1) [Psychromonas sp. CNPT3]
Sequence
MKFFIRLFICLYSAISYVQAESSFLSVEQAFAMHSSIENNELHIKFDTASGYYLYKKRLS
IQSTSDTLMLGEHIYSEPATPKEDLTYGKVNIYAKPFSIRIAFTGQGQVKLRYQGCSDAG
LCYLPQSRNIDVQTITSRANIAILNADSPQNILSSPLKNDATGLSLLLEESNIWQALLLF
FVLGLGLALTPCVLPMIPILASILGGQKGKMSGWRGFKIALAYVLGMATSYACAGILTAT
LGQSMNLQAAMQQTWVLCLFALIFVGLALAMFGVYELQLPARLQTYLNSRSQKIKGGTTI
SIFIMGALAALVVSPCVSAPLAGALLYVSSTQDWMFGGLALFTMALGMGIPLLIIGTTGG
KFLPKNGPWMVAVKQLFGVMLLAVGIVLVSRFSSDVVILSLWAALTLTLAIHYGALENAI
NARQRLRKAGAFVLLLYGIALFCGAMTGAHDPLDPLQNIYHKDDMPSFVTTPNKPLFTKV
STLIEIQENIKKAQLNKQITILDISADWCASCKVMDKTVFQDLDVRAAFTAFNALQFDIS
KPTDAQSKWLDNKQIFGPPAILFLDKDGKELRHLRLLGEIDKTQLLDALQRIKTLA
Download sequence
Identical sequences M4U3C1
gi|470478195|ref|YP_007638939.1| WP_015463983.1.69606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]