SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478688267|ref|YP_007745077.1| from Streptomyces albus J1074

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478688267|ref|YP_007745077.1|
Domain Number 1 Region: 463-711
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.13e-57
Family DPP6 catalytic domain-like 0.0036
Further Details:      
 
Domain Number 2 Region: 21-350
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 2.75e-29
Family DPP6 N-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478688267|ref|YP_007745077.1|
Sequence length 713
Comment Peptidase [Streptomyces albus J1074]
Sequence
MPTEHLSFPRQHARTQRFTLGAPRAFTVAPDGSRVVFLRSASGTERAQALWVLDLEGEPH
ERPVADPAALLAGAGEQLSAAERARRERSREGGAGIVGYAVDEAVETAAFTLSGRLYVAD
LRPGGTSPAPVRQLDVPGPVIDPRPSPDGRYVAYTVRGALRVVAADGGGDRAVAEPEAES
VTHGLAEFAAAEEMDRSRGFWWAPDSSALLVERADDAPVTRWWIADPARPAAEPARVAYP
SAGTPNAEVRLFAYPLDGAGRTEIGWDRKRYPYLARVGWDAHGPLLLVQSRDQRGQLYLA
ADPATGETRMVHADEDPRWLDLHAGAPARTPDGRLVRITDEGGARVLAVGDRPLTSDAFH
VRGLLDVGADDLLVQVSAGPGAEEPETGEIHVLRVNELGTERVSTGAGVHGAARGGPVTV
LVSSTLERPGQRARVLREGEEIAVVASHAESPVIAPRPTLTRAGKSKIPAVVLLPSGYRE
GDGPLPVLLDPYGGPHGQRVLAAHNAHLTSQWFADQGFAVIVADGRGSPGHSPAWEKAIH
HEFTATLDDQVEAVHALAEEFPLDLSRVSIRGWSYGGYLSALAVLRRPDVFHAGIAGAPV
TDWRLYDTHYTERYLGDPAEADGEVYARNSLVTDEGLSAAAAQHRPLMIVHGLADDNVVA
AHTLRLSSALLAAGRPHEVLPLSGVTHMTPQEQVAENLLLLQVDFLKRSLGMA
Download sequence
Identical sequences D6B5G0
WP_003950655.1.19862 WP_003950655.1.69503 gi|478688267|ref|YP_007745077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]