SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC17977 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC17977
Domain Number 1 Region: 239-324
Classification Level Classification E-value
Superfamily HMG-box 1.57e-23
Family HMG-box 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC17977
Sequence length 587
Comment pep:novel supercontig:GCA_000297895.1:scaffold44098:370940:389812:1 gene:CGI_10017717 transcript:EKC17977 description:"TOX high mobility group box family member 3 "
Sequence
MLDIESPAISSGLPFLSSSVMGDVCGPEATYITNETFHTPSFDDDFDITPLNSLPVSNSV
SHALPQVQTSYSQHSYPQFVSHQYHPYSQHHHTPVTSVAPLSTTPIFPPQNFDIPDISLT
NNFDPLVNSLTSMAMMTSSIDNGNPNSSFVQSSMAVTAPTMANNAAISVIKMDDKYMEPN
QQTSPSHSSNSISPPRESSEDSSDDCLPLAQLMKRQAAAKSIVEEKEPSPPPPTGVTKTR
KTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGGNPSASFGEVSKIVASMWDSLDPDTK
NVYKKKTELAKKEYLKQLAAYRASLVSQLPMDDNNPYGNLMDKNQFVRQAQNSPMHMSPN
VSPPQGAWPMTSMTMQNQSPPGLHGMSPQGHSPDSHGMSPQGQGISPLHHGANMSPSMGD
MMMGPPSNSPPNMGYSPQHPHVSPQHMVSSPPRPVQQIAPRQPVLGQLMEEANICLDGGD
MMQSMCIRNGCTNPTIESPGWDNEYCSNECVVNHCRCLKTAIAARGLLKQDVIVFSRQFN
IRDTGKHPGTERSSLADVMVHAMEVSNGHRAITDYKEMLAIVCSGMR
Download sequence
Identical sequences K1P2D8
EKC17977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]