SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC20786 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC20786
Domain Number 1 Region: 478-545
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000144
Family HMG-box 0.00095
Further Details:      
 
Domain Number 2 Region: 33-89
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000017
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC20786
Sequence length 569
Comment pep:novel supercontig:GCA_000297895.1:scaffold41650:113726:123559:1 gene:CGI_10005340 transcript:EKC20786 description:"Transcription factor Sox-14 "
Sequence
MKSNFTAIPMTVLDQLTNAFVKEILLMTTQWVRHHTLNESMKKVCERVPGYSDVMKETKV
VMMQKIIAYVCYLENTVHDLCEKLDLKVGDLLMSTDFITEQLRTKKATTEHILFSLALKK
DPPVLKQKTKIKSDHKKHQLEQRRLKISSPTIDSTTDHQLVEDYESSQESGVGTSVGMHS
FPYLRDHKWLTSPIKNLMDISVCGESKDDPDEEGFFSQSTQGILSQLIDTPSKLINDDFL
PSSSCLDNFPDAFDLMSSPIGKRSSQLNSPRERILLNSSYGIKNDVQDYTEAAEHTDGEM
RTISPESILQTNVYREDVFLSQASEPLSQHNTSGLSDISVFLSSPERPSMQNTPVKSPYW
PGKNKRKQYTPKRSPFNNITNLRLQPSVSEEEEEEEEEEEEVDEDYEPEPAAKRFKSDSC
GKFLRRSPVDEDFVSYVPYIWKFHNTSRSRRQKATPVPEKCSQDSQEPESENKSSVCKPE
KIDHRKTTWMNGFMMFSRYNRKKFIEANPGVHTSHISKILGHTWRNMSAEDQKPYKDEAK
LYAKEMRNDNLTCQENSGDVELSSPEKTE
Download sequence
Identical sequences K1QGQ0
EKC20786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]