SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC21391 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC21391
Domain Number 1 Region: 17-96
Classification Level Classification E-value
Superfamily HMG-box 1.44e-25
Family HMG-box 0.0000788
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC21391
Sequence length 258
Comment pep:novel supercontig:GCA_000297895.1:scaffold40246:74066:75642:-1 gene:CGI_10003991 transcript:EKC21391 description:"Transcription factor SOX-7 "
Sequence
MPETGSSHEFIPNPPQGKRGEERIRRPMNAFMVWAKTERKKLALENPEVHNADLSKILGQ
KWRELSPSQKKYYSEEADKLRDLHMQKYPDYKYRPRRRKAKFKVPHDDNRTAYDFGEIEG
VVLNSGHLTPPASPVPSHPKMVIPFSVSEEMSFDHTMTDATLNFREYPDTPPYYNRFKGF
DFSDGCSNTRVEMCHYLQERSLTFLHGAMSSAIQCPELDTPENYVLSSQELRDVTEIDST
EFDQYLKADDNVKCTTET
Download sequence
Identical sequences K1QIB0
EKC21391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]