SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC22539 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC22539
Domain Number 1 Region: 159-256
Classification Level Classification E-value
Superfamily HMG-box 0.00000000144
Family HMG-box 0.0022
Further Details:      
 
Domain Number 2 Region: 286-345
Classification Level Classification E-value
Superfamily HMG-box 0.0000615
Family HMG-box 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC22539
Sequence length 655
Comment pep:novel supercontig:GCA_000297895.1:scaffold36728:12497:34643:-1 gene:CGI_10002098 transcript:EKC22539 description:""
Sequence
MASTVYLCHCLKSVKRKVQLQSVAWKRLCNQNKRLEAEEVEKKKLKKNKKVKKKENSQPT
EKGDNVESSFTSPEKVKKQKKESGWFEDDIEALLESLENMEEHADFVCNKVPPEVWSSLR
VGNHSPESCHKIWNKICQVVKTHLTIHHVLMIMKDMMHSKKIMKIPGAPTVKIISGYQCF
TKERLAETPPRSFKDIGAEWKALSDSERGRYQEKADKKQPSKSKSQKEINEEAKRELEKY
VKSLTDEEQMRFFKSRKLTEKPKARVKKEKKAKGLSQRDFKKAELQYLKEEKKIAIKENP
DLEEEEVLKRLSEAFRSLDYETQKSYCRKAEISLQEQKKITEFYKNFESPLAKKKLTSLG
TPPSQIKSSRKKDSTTSESSDSSSDAEEEKVSKRKPPVLVLGKKAETDSDSSSEDERSGK
PVVQSPVKRKVRDKSSDSDSSSSSSNIKTGTNLNISPKKPVSSRKNVAKVKNVKKESSSS
DSDSSSDEEPKTTGRQTGPSLKKAPVNKKPESSSGSSSSEDEANKTQKKHQARSSPTKKV
MLNDKTPTKSPKKLVNSEGKKKSNDDGSSDMSDVLPLTQSSSPKKSAKRPPPPSSSSSDL
SSSDSSSESDDGKTGSQKQSGLSKTPQHTLKTSLNTSMKSISTPSSLKTLKKKQK
Download sequence
Identical sequences K1PUF9
EKC22539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]