SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC24431 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC24431
Domain Number 1 Region: 4731-4984
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.17e-68
Family Cellulases catalytic domain 0.00000244
Further Details:      
 
Domain Number 2 Region: 306-564
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 6.54e-42
Family Hemocyanin middle domain 0.0048
Further Details:      
 
Domain Number 3 Region: 824-961
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 1.44e-18
Family Hemocyanin middle domain 0.012
Further Details:      
 
Domain Number 4 Region: 1868-1930
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000908
Family PHD domain 0.0026
Further Details:      
 
Domain Number 5 Region: 2187-2248
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000487
Family PHD domain 0.0034
Further Details:      
 
Domain Number 6 Region: 2261-2328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000354
Family PHD domain 0.011
Further Details:      
 
Domain Number 7 Region: 2140-2197
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000179
Family PHD domain 0.013
Further Details:      
 
Domain Number 8 Region: 1821-1879
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000642
Family PHD domain 0.0095
Further Details:      
 
Domain Number 9 Region: 2828-2868
Classification Level Classification E-value
Superfamily HMG-box 0.00000106
Family HMG-box 0.0025
Further Details:      
 
Domain Number 10 Region: 1957-2019
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000111
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.06
Further Details:      
 
Weak hits

Sequence:  EKC24431
Domain Number - Region: 86-176
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000161
Family C2 set domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC24431
Sequence length 4990
Comment pep:novel supercontig:GCA_000297895.1:scaffold1800:806:94076:1 gene:CGI_10016397 transcript:EKC24431 description:"Histone-lysine N-methyltransferase MLL3 "
Sequence
MSSWQKGGFNLTEKGYYTLIVDYGNTGVANMKSSLEEFRFNTVQIQKVGSGCLLKSFVKV
KLNVACSVYIMTSYFRPKAREPEEVLVFPKEIEENNSISLICAAYVGSPRGYIHIWRVFQ
NSNKSKLIYKSNFINNETENCTKYINVTTTYTVTREDNGAVFRCSSQNNLTQGPGLSKYS
QNISVLWNMASFFNAAILLGLLGLSSALLEPIPFPTELQECYEYRSDNVTASAESAIYIQ
NTCYRSFLTDQMTDGKVWSGENLTQEGINYIDSLFRRIMAEADEVEKYKKLGGRQKRQTS
TRRFRQEVRSPGAFQPYANCVQRLQNETVEPASAGRNTYQTLAAFHSGRTLGRAHNGPAF
LPWHRIYLLLLETECDAAIPYWDSGLDHDMVDPTTSILWSDQYFGNGDGEVMSGPFQDMR
TLLGTPIIRNYGTGDSSLFTKEGLRAVLSRRRFQDISEPLPRGSIYSLEGHHNGPHVWVG
GHISALNSAPWDPVFYMHHAYVDAVWARFRELQIQNGFNPETDYPRRPRQGHRRNDVINF
GPYFELVTNLEAMANRFADLVTYEPFPVCENNCNNSPHLYCDQLRLVCISRIRTAVQTSV
AGIVAMGASRGVSSNIQSQSLARAVARGPLPVGRKFSDSPFIDIRNRPDNIGTARAAPQI
RRASSQVRTRARRVQRAVSQNAAFQENHLQSVSSLERSFTNTFVIDGVVDVKRWVYIPVR
IVYSRSKNLKGIDPTLFGTVNQSQEKCQTAHSGASKVFVSSNGLNYYGMYTEYAIIDNRQ
PVYSTAMVVGVKNPEYGEGETLFTAYDSCGRPCRPVCQTSVNGQRNYKGCNSALFTKAGV
RAVLSRRRFQDISEPLPRGNIYSLERHHNGPHVWVGGHLSALNSAVWDPVFFMHHAYIDA
VWARFRQLQIQSGINPETNYPSTSQRGHRPNDVISFGTLFERVTNIQAMANRFANLVTYE
AFPVCENNCNNSPDLYCDQNRRVCISRARANSPATASGFVAMGAARGVSLDMQSQALDRA
MARGPLPVGEKFSDSPFHDIRNRPDNLGTARVATQIRRAHSRVRRHSRRRRMQRRRVRRS
ATLNATLQHNHLQSVSALERSFTNTFIIDGVVDINRWVYIPVHVIYSRSQNVQGIDPTLF
GTVDQIEDTCQTAHSGASKVFVTSNGLNYYGMYTEYAIIDNRQPVYTTTMTVGVKNPEYG
TGETLFTAYDSCGRPCRPLCLTFVNGQRNNKGCSGAFRVSTSSPQMYSITYSDALNSTLM
TYSQIDTHADFSAPALTFLCDNKPETVKLENTVEEAGTQLSVDTIESSVAADINSDNSQS
STSVPPDITQADTYSLDDPYTSDPPDLNPEEDTNLPTKVIKKEGEYLTLPTYEAAELSDS
SGPPDITSAAYEKTEEVEDIEIKDYSYVDSPNSPAPLLTSLEEQGEFTDFPTELPEDPQN
IFPDTDPPPDLLHQEDLTPTEGYLGSSFPESSLSESLLAVAPGDILPVVSLPQINPNFFQ
QNLSPTLAQNIKRGPGRPRKDGQEPAPRRRSSSKPLAKSIVTKAQRILHNSAGISRKFFP
SAEQMDSGSQSSLSQSELTMTIDTGEDTTQYEMEEEMLIGVSESLDETSLESQLPVRVCS
FCNCGERSLLGQGDIFRFEPTQGFNFRKTLAKNDKKPADFDERNQEKEGTTKPLTWRRNR
GPIKGVGEREREKSHSPRRTGNEEDQNILLGDELTFLGFPEDVEAMQVFEPTGHVWAHNR
CAAWSEGVTAGVDGSLLSVDQAVFNGLSQKCSYCRRYGATITCIYPECSKKYHYPCAAAG
ACFQDKKKLAILCPDHSDQAETIAGEEAFCVLCCQADKIGKQLFCTSCGHHYHGGCLHPS
VALSPEVRAGWQCPDCKVCQMCRQPGEDSKMLVCDTCDKGYHTFCLKPVMTAIPKNGWKC
KNCRVCGDCGSRTPGSGPSSRWHLNYSVCDSCYQQRNKGLSCPLCGKAYRQFTQKAMIQC
GTCKKHVHAECDDAIDNLMLDRVRNEEQVDYMCSVCRNRDPEFSSPPHIHPHGEGCGIGS
KGGKLNAMSRKKIGVSSSSSSRSRGRPVAPEKKKKPPPSYSEGKRGSKTKMKSNQPGAQA
QISPAQPGEPLKKSQFPTEDDDDGDDHPQTIILSNAQDKFVLDQDVCKSCGSFGRGEEGK
LIVCTQCGQCYHPYCASVKVTKVILSKGWRCLDCTVCEGCGKPHDEGRLLLCDECDISYH
IYCLDPPLDQVPKGTWKCKWCVMCINCGTTTPGFGCNWQNNYTQCGPCRSKIDCPVCRHK
YQDDEMIIQCLQCNRWLHALCDGLRSEDDMERAADYDYQCLFCRPKTGKDGPLPPPPPPP
TPPPIEMEEPPTPPFYREPEPIPQKRYLMDGVYLSETGVQHMQEITIQIPKVKRQRRNNK
RLSVDMLPGQRLATQMSTEGDEEKDGMDEGSELSTPVTAEARGEGDPLLLSPTSQAPSGI
PAEGEKKERKKRTTIGLGVGGFIAKARSRQTNVKRQMSEVSAEMADGQPRPEGEDGEPVP
LLVEGEVKKQRKRQARKKSQLENSFPNYLQEAFFGKDILDKSKAKVKQGHRADSDSDTES
RASTPNLPKDIPQPSLFPELSQSNTKLPSTLPSVGTSQSVLSSGASMVPSFPGTGDDINP
IGDVLPDLELPHDDIFSIFKEGGKFLLSILIAKLPMSEEQPTSSQAGASGSGELPDILSI
ENIDVDLLPEHAEDLPPINGQEVDDIFNGVLPPEEDPSQAAHGGGPQFPMPGSVPRLPPH
MPPHPGQMPPGMPQLPYGPDFRGMGGDQPPWQQVATEEEGGGSTSSRRNMLKWECDEDLG
ESATISAVLYCNLRHPEFKQQYPDWSERVKKIAKAWRELSSDEKQPFLTQDGKKPKTKVP
SMPMGPPLPPGPQGQMPYPPPAAADNLGSPVVLSPSNRVPSNPSMVTTPEGHSPGQMPGS
LPESPLSHPGTPQDPRMMVGHGDPYNPEGETDDFAVMVHPGMRHPQGGPQRPPMARNPSG
GMDPYSQDPYAKPPSTPQTPQKSPSKIQWPGQAQESDPYENPPATPAEGMSSGHPGHPYD
PYAHPPHTPRPGMVPPQGIHRPPFTRQSSVPATQTSHSDDPYAFPPHTPGPRPGGDGQNP
DIVGRQQGADMYPGMGDHLRSPYPPSSVPGSMGQPLPSTAPDIYRMAGQSGMRHPFRPPG
PPTSQSMARPDLYAQPLHPGMEPPREQSAGLQDKNSSGETSQQVRNILHKQAESRMRQGK
GSEPPQPPWENHPQAFTSEEMTRFPVSRGAWPPAPPRVPGPRQIPHPTDMENFGMRPPYS
EGVHPGQMRQPRPHGPMMPEMYSPKHSPQMSPGQLPSLRPGQNPLAGHDPRSQFPNMMEH
RFPVPGQQVPPNQQQVPNISGQPQTYKSYPPETGEQSRINPGAMGEQRKMSDHDQREEEK
SVETKEEKKELVEDKQMNEADIEELLSSDGTFDIIKFVDTDTELNLDENKSIFDDLDDVE
SGSMDKGDSKEDMKMTKEKMDSDLDSSKSGGGIPDFQSKFLEFSQKKNEERKIGAEGSGQ
MSEMDKKDQQSISQIAALLQQQSSEHMPPTLERRDSVKSDSSLPGKEQLPRTPGSGPLTP
SGKQPGVDQGFPGMGSRGPYSAGMHSPLHQMQSIPTQPSPGSTYPPGQGPPTPGLPSPKI
MPSPRSNIPSPRTPSVQSPFNPMNSQQSPFPQTQSPFSPTVSSAPQSPYAANKPQPSFSL
PVGSTNQPGYSTVESGVPVQSPGQRSPRGTITPTNQYMQGTYGQPMMQGPPRATTLTPTP
TSILYGGQSGMAQHGMRNPVPASMNGSRPPFSGASAHPMGHSMETATSQMHSMDPSAVPH
MATSQSSHTPGDMQGHPPSSQSTATMPPYGMPGQRMPGIRPPMGIPTSSVPSSAPGALGG
GRPQLLQDQPLLIQDLLEQEKQEQQRQAQQQAMGMMQRPPPEAMMGQPPRPGMPMGQYRP
RMEGMRHPVDPNWNVQRPYGQPEIPPGQPQFVRMPGQQMPPRMPGPYVGQPPGVVGPMGI
PTPPPPPPQPPMTGELTPELERQQQQYEDWLMKHGNYLEMQVKTLEQQIGKCKRTKKAIN
ARNRQAKKTGREPSANDATELERVTQEQAGLQKQLESYRKQVKQHQMQTQDYRTKKRERY
GQDWAFSQMPPVTGPAIMNVPPGGLQPRIPGQQGSARLTASARQAYDEYMQDRLRQNQQI
PGAVGGPRPKHTVVEDNNPFSEEYQEREQRERVGCLPKPGPEPEKPEMMRQMPPYFDPRT
IPYDQTGRFPAPRMPGPAEPMQRFPGPAATTVGTAEPRPPVQFTPQSETEKRIMEILNNS
AGLAARSQHEAVDKSPGKAKAGDTQGSPATEQKPEGRKPEEGEGAQRVTSVSVPGPSTQP
TYTTAVSQPAYQSESNDPDDQQEEHILPMNVMIHQSIPQSAAIACSVPPVQVSQSQQMEA
ARIQESESMPQTAAKSVEGSVQSDQGHTQERPPISGSSEAQPVSSVNSNVNTVQEPETVS
TNVQHLPPHSYPMTSLPGHPLPPPNTQERMSPRGMVPPAYMGAYGHFQGRMSPRQAHYGG
VPPTLMPVSQNQSPRQSTTPSPGRYSPRQASPSYPGGPSPGRYSPRQGSPGVSRPPSRPP
SQPGSGYAPPRQGPTPPITGYPSSTPPASPNVTYSPVTTFSAVSVDISSRVETSVAHTTI
NSRPNVSTSTVQSVSQNTPTDSVAPPPATESASAPVVEQSNLKLQDTNTTGDHVKFNLPM
AFSAHVLAYGLNRWKDGYSSSNQLQNMYEMLRTPLDYFMKCWRPQSQEYYAQVGNGAADH
AFWGRPEDMHMQRPAYKCTASNGGCSDVEGITVAALAAGSMAFKASDAAYSQRLLASAKS
LYDFANAHKGIYNKGPISDATSYYGSTGYKDELCVAAMELYKATKDAKYLNDAKANFEGN
DVAWALSWDDNHVMCELLLYEETKDNRYKGLVESFVRSYMPGGSVHQTPCGLAWRDQWGS
LRYAGIFQRE
Download sequence
Identical sequences K1QS65
EKC24431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]