SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC25031 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC25031
Domain Number 1 Region: 548-657
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-29
Family Bromodomain 0.00051
Further Details:      
 
Domain Number 2 Region: 399-491
Classification Level Classification E-value
Superfamily Bromodomain 6.02e-28
Family Bromodomain 0.0016
Further Details:      
 
Domain Number 3 Region: 215-339
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-25
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 4 Region: 1378-1449
Classification Level Classification E-value
Superfamily HMG-box 2.49e-17
Family HMG-box 0.00063
Further Details:      
 
Domain Number 5 Region: 796-881
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000000000327
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 6 Region: 2041-2314
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000000000915
Family All0351-like 0.099
Further Details:      
 
Domain Number 7 Region: 725-786
Classification Level Classification E-value
Superfamily Bromodomain 0.000000000000523
Family Bromodomain 0.003
Further Details:      
 
Domain Number 8 Region: 932-1019
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000000275
Family Bromodomain 0.0051
Further Details:      
 
Domain Number 9 Region: 2376-2539
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000288
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.027
Further Details:      
 
Domain Number 10 Region: 1818-1873
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000961
Family B-box zinc-binding domain 0.0043
Further Details:      
 
Weak hits

Sequence:  EKC25031
Domain Number - Region: 1634-1643
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC25031
Sequence length 2552
Comment pep:novel supercontig:GCA_000297895.1:scaffold1737:465811:530668:-1 gene:CGI_10018256 transcript:EKC25031 description:"Protein polybromo-1 "
Sequence
MLYVFTVQSVMTTLGLLLLFAGSVGGAGIHGIHDALTKGLCLCVADNDIYARDGPGEEHK
VVAVLRQDDCFVSKGGYLHIFGATWYELLNVQNQVGWVNAYHLRVKDRTACAVSATVSST
PFSITGSDPFSGGDIFRAGTCTEGGMCKEHQVHDQAKQPHPGVVRGAVTVGPHCPRGQGV
RVTPTLTRTICQKMPGKRKRTSTIGSERQSEEREESPAPTSQKRKRKAQYDPVEICQELY
ETIKTYKGEDGRLVCETFIRVPQRRAAADYYEVVATPIDLRKIQQKLKMEEYEDIDQLTT
DVELLVSNAKLYYKKSSQEYKDAVELLEIYHETKSELLNEAFGEPEQPRVERRRSTRQAA
QEVDEDEEEDDAPVEKQSEDVKDDPQEIEELFAAAMNARDGDRDISLVFQLLPQRSKYPE
YYKIIKNPIDMKMIAQKIQGNMYNTLNEIERDFFLMVKNARTFNEPKSVIYKDAVEMKRI
VQKKKQEIIQRKSMVPKPPERVRTRNLQKMSAICAALKYPSDDEDDEASLDASLMDYDDD
SGAETIMSEDDNLYVMLLNAVKNYKLSSGETVHEPFIKLPSKRFYPDYYEEIVRPMSLSN
VRKKIKFNQYRNLEEVAADLNLVFDNARQYNADDSLLYQHAVILQKVMIDKKRELERLET
NKDLGLDDMSSSQFDIPVMKISRDYFDEDSQMSSSSKQRRSGGLSDSDKKRAKRATPEEM
MKRRLWTLYRSVFDATYPSEQHIINDFELMFNNARLYNEEDSLVYQDADQLERVLKTRWK
QVCHVIESRRAALSKRYHRHKAKSQTLLPVRLQEMYDAVSNYQDPKGRDLALPFLKLPLK
TDYPDYYEVIKKPIDMQKILLKMQQNQYESIEDMTADFDALTLQRLVLEKKMELADDGTN
DVPDVRALVMEMMTNLFISTYNHQDEEGRCYSDSFAELPERDPDEDLETSKQREKPLSFD
QIKRNVEKGRYIRMDRFQEDMFKVFERARRLSRTDSQLYEDAVEMQMFFIKQRDEICRNG
ERLLTPALSYQEKHLTVALDAEKQSKLEQEQKEDEDKQSKRESEERILDPDSTEKEGEDC
FKYKDETFRVGDFVYIEPREKGLEAHIMCVEKLYTDNNAQEHLHGNWFYRPNETFHLASR
KFLEKEVFKSDFYTSIPISQVLGKCYVMYVKDYFKSKPEGFEDKDVYVCESRYSNRHKSF
KKIKVWQIPGREQVPLLPREIPLVPVRVSSVFASRKEEEVDDGDTSDTVYLKNSTEVPEI
SRVEKIFVINNDVYFTGTAFVRPADIPHSPTRLFYRRELFLSSQETKYNLSGLVTDDEIF
FYKKPITPQKEPSPLLMKAADDTFMDDSQDSTLMDTLDDTNMSFDMEASHQGFPEIPTPK
PTKKGKNSMKRQISGYIVYSGEIRKIIQQENPECTFGEISRIVGGKWRNLNKEDKEKYEE
RAKRIAEEQLAKQQEATKAMNDSLQGQWDSSGGKGSPAPSNRPGTPGGMQGQYQGHMVQG
LHNGVPRLPPHSGMSPGRQYMPPYHGTPTGMRPMTGGYPNTPPNSMLPGHLAGTPQGGMS
PYSLTPHPPGQGGGAVPPNMCYSISPPSLSASGLSALQEMLRRPFNSPSPGATVSVTTAE
FYPTVETGQQMAPPPPPPPPPRPPSPMFVSVPPRTQRLLHSEAYLRYIEGLRADKPFISD
WDKNLTANAENTSTDPNRLPAHWLAEGPGYHGNTSNALWALRDLMLKDTLNISRTLSFEA
LCSGGGCSWICITFYIMNTASSTYRIHKCSKCPGDTGYHCVSCPCDLCPQCKENHVKDLN
TIDHDVVSHRDKINYIPTEEICVGHPSKVYVNYCEPCKLPVCFHCRKHRNHRQVDVNRAY
KTKREQHRGTIHTIRSEALFYRPVLLTGIEADFKTCRTEFSLYQSEMLTKAKTLKNLINR
VTKNFMYNVFCDFNFKHRCLKQKIEMSRHINSLQRYIHRYEQPEFTFSPLQFLSSIKKAL
TEIHLMLHTSQLSMTESLKKEDVMESLSAIQIKERGTRRVENQCLLKLMSSAEFHQSLTV
TGVDCSYHISCVTSDRVWVSDRNNLILTNTKGVCLHCVEGDLFSDSGLHTLTNESELIYI
DCNDDINKLAKDINTTKTFIEKTDSTWEPRCVHWSPSTGDLLVGMSRKEPKEKEDKEDRD
NTADTEIITTWTGKVTRYDQSGQLTQTIQYDNTGRKLYRDPLYITENNNGDVVVSDYKAV
VVTERGGRHLFSYTGHPSGSRLWPLGICTDPLSHILLCDDWTNAVQMLDQDGQFLSHLLI
RPSGIFYPRSLSYDVNTHRLWVGSLYNNTVVIYRYITRQLALTATADVTESLNEIPTTGT
EKPQQVNECLLKMMSPPELLHSLTVTGVDGCLHISCVTSDRVWVNDGKVTRYDQSGRLTQ
TIQYDNTGRELYTEPNYITENNNGDVVVSDCYYTRSGAILVTERGGRHRFSYTGHPSGSG
LEPRGICTDPLSHILVCDAKTDKVHILDKDGQFLSHLLINPLGKFGPCSLSYDVNTHHLW
VGSRYNSSTVLIYRYITRQDTLTDVLVLFGNF
Download sequence
Identical sequences K1QU16
EKC25031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]