SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC29138 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC29138
Domain Number 1 Region: 195-428
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-81
Family SSRP1-like 0.00000337
Further Details:      
 
Domain Number 2 Region: 546-629
Classification Level Classification E-value
Superfamily HMG-box 1.44e-24
Family HMG-box 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC29138
Sequence length 757
Comment pep:novel supercontig:GCA_000297895.1:scaffold1219:214823:223922:-1 gene:CGI_10024258 transcript:EKC29138 description:"FACT complex subunit SSRP1 "
Sequence
MSDFQEFPEVVQEVRGALNPGRLKLQSNSIIFKNNKTGKIDQYPGTDVEKVHWLKRARGH
CLKFLLSNGTIHRYDGFKEGEFEKLAAFISKYYMVSLEKKDLSVKGWNWGIAHFTGNALE
FDVDNKIGFEVPLSHVSHTTTAKQEVTLEFHPNDDAAVSLMELRFHIPPDPKDTEKDLVQ
EFYNNVLEKADIIQATGDALAVFTEVQCLTPRGRYDFKMYNTFLQLHGKTFDYKIPYTTV
LRLFLLPHKDGRQMFFVISLDPPIKQGQTRYHFCILLFNIDDEMSIELGISDEDLQEKYD
NKLQKEMSGAEYEVISRVFKAVTNRKITVPGSFFSNTKSHSISCSYKAATGFLYPLERGF
IFVHKPPIHIRFDEVVTVNFARSAGTNRSFDFDVETKSGTTYTFVGIEKDEYGKLYDFVS
SKKLRVKNINGKGDKAPYRDDMSGSDEEDNHDAYLERMKAEGKDRQSGDEDDDSDSSDES
YNPNESASDVAEEYDSNPPTTSSNSESGDSSGGSGDEEKQKKRKEKAEKKKSRSAKTVRE
KLPGSEKKKKKKSKKDPNAPKRPQSAYFLWFNANREELKKDTPDISITDLSKKAGEVWKQ
MEDTDKTEWNEKAAEAKKEYEKAMEEYKAKKKEASDDEGDDDSSKKRKSPKKSPSKSLSD
SRAGAGTNYKSKEYISSSGSNSSGSDSDDKPLKKKPKKDQGTKEKKKKEKAPETKRKSKR
QNKGSESESSVGELPDEEEILDTPPSSGKSASESESD
Download sequence
Identical sequences K1Q5H6
XP_019920150.1.10878 EKC29138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]