SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC29938 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EKC29938
Domain Number - Region: 178-212
Classification Level Classification E-value
Superfamily HMG-box 0.0288
Family HMG-box 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC29938
Sequence length 237
Comment pep:novel supercontig:GCA_000297895.1:scaffold1140:2113:2826:-1 gene:CGI_10001239 transcript:EKC29938 description:""
Sequence
MHKLSLKKYTFGKMESQDDDHDIPCNQEQVTSIPDSDEDFDYNLDLTNLELTSSIKEANQ
DNAYADLLSDAVDSFETALTSRHSIACAREGLSYAIMSGKLPPYMRWHLECRPNLGDESI
NKEFQEIWKTKTNTIRDKILKSSVDFMDDKIGLANNKLREIRGETLSAIGKSTQAAGAAK
SKFNEKTRQLKEEFDRKLLDFKVNIRSERKSTINQHSRRSYTAKEKSVKKGQKFRPY
Download sequence
Identical sequences K1Q7P8
EKC29938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]