SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC30061 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC30061
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily Putative cyclase 2.09e-25
Family Putative cyclase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC30061
Sequence length 149
Comment pep:novel supercontig:GCA_000297895.1:scaffold1123:368453:368902:-1 gene:CGI_10018740 transcript:EKC30061 description:""
Sequence
MPRHAIVVMNSGWSSRYPNKTLVFGTSTPTDVSTFHFPGWHENAVMWLINKRQVNAVGVD
TPSTDYGQTTNYPCHVIMGENDVVGIENVANLDKVPENGSTIYLPVLNIFDGSGGPARVF
ATFDDESNKNEPRCNPDQLQALCRLIRKY
Download sequence
Identical sequences K1R807
EKC30061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]