SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC31179 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC31179
Domain Number 1 Region: 461-708
Classification Level Classification E-value
Superfamily HAD-like 2.56e-46
Family NagD-like 0.00082
Further Details:      
 
Domain Number 2 Region: 170-254
Classification Level Classification E-value
Superfamily HMG-box 1.7e-21
Family HMG-box 0.00051
Further Details:      
 
Domain Number 3 Region: 283-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000119
Family HkH motif-containing C2H2 finger 0.032
Further Details:      
 
Weak hits

Sequence:  EKC31179
Domain Number - Region: 399-490
Classification Level Classification E-value
Superfamily Prefoldin 0.0233
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC31179
Sequence length 718
Comment pep:novel supercontig:GCA_000297895.1:scaffold1009:1721971:1735405:-1 gene:CGI_10028818 transcript:EKC31179 description:"Phospholysine phosphohistidine inorganic pyrophosphate phosphatase "
Sequence
MEQDMMTMACTVENAGDGCITDPINTLSPLGETDKGDVMQTSQTAYLITDSNGLVLLETQ
RGNMFLSVSNEMNNLNYTGISTSPELQGRQLLTTTAAGSLLTGVQQEGMVDPQGVGVLLG
VQTDVGEGLDTEDISDTTTEQLLNNTDSISVSPSEKESQKVPEQKKRGGWPKGKRRKNVP
NVNAPKAPLTGYVMYAIERRQEIKASNPELSFPEVTKILGNEWSTLDSQKKQKYLLAAEE
DKKRYMEQLKTFQQSEAYQSVMKKKKGKGFLTGTEIHVDETFPYSLDEDEGSMNELYCRV
CDQYFSSLHNKKEHMFGRQHLQNITGEIQKDMQLQAEQESQDLVESSLVSSHLGNESSQS
GDGICDSQHDITEKTSPVDVQGFIHGFLQENLDREFEIKQIRRHFKLIQEENTFLIKQIT
ELKHYQNKLEDELSQYKEINTNRQGGRRADNTMASWNNNRKIKGVLLDISGVLFESGAGV
PIDGSVEAVKRLQSAGLPVRFCTNETTMTRNMLTEKLHRLGFSMKDEEIFPPIPAVCKVL
QKRNLRPHLLVHPTAALDFEGIDTLNPNCVVLGDATAEFTYHNLNKAFQALMSMEKPILF
SLGMGRYYKEEEELVLDVGPFAKALEFAADVKTEIVGKPSETFFSSVLEDMGVSPENAVM
VGDDIVSDVGGAQACGMLGIQVRTGKFRPQDESHPKVKPDSFADNLLAAVDLILQASK
Download sequence
Identical sequences K1QJ13
EKC31179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]