SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC31425 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC31425
Domain Number 1 Region: 632-848
Classification Level Classification E-value
Superfamily SET domain 9.55e-71
Family Histone lysine methyltransferases 0.00028
Further Details:      
 
Domain Number 2 Region: 513-620
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.73e-23
Family PWWP domain 0.00011
Further Details:      
 
Domain Number 3 Region: 2-143
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.53e-19
Family PWWP domain 0.0058
Further Details:      
 
Domain Number 4 Region: 464-530
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000111
Family PHD domain 0.0045
Further Details:      
 
Domain Number 5 Region: 860-933
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000062
Family PHD domain 0.0032
Further Details:      
 
Domain Number 6 Region: 180-247
Classification Level Classification E-value
Superfamily HMG-box 0.0000000943
Family HMG-box 0.0021
Further Details:      
 
Domain Number 7 Region: 311-357
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000509
Family PHD domain 0.021
Further Details:      
 
Weak hits

Sequence:  EKC31425
Domain Number - Region: 358-413
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00159
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC31425
Sequence length 1079
Comment pep:novel supercontig:GCA_000297895.1:scaffold975:68099:75708:-1 gene:CGI_10013318 transcript:EKC31425 description:"Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific "
Sequence
MGDQLWAKVAGHPWWPCMVAKDPYEDLYTKMKARSRLYHVTFFGNEGERGWAGSNSIMEF
KGKDKYDEHVKQAFLNAKKGEKLKLEKLYREYPNRQAAWLIAIHQAEEAMTMSVEERVEK
FKCVCTPEKKKKKSTDSGNDNKQVKSPKGKSKERIQKRKRQSSEQVKSSPAPSPAAKPSS
KRRRLDEGSSHKDKKSEGSFEVFCSKHRDSMMADHPEFDEATLNECLQQQWLMMSQKQKS
RYKSKLQDTPKEPVISKVAERKMSPTEEEDEDSEKETKIVAKLKLKREKSTSDESSSDNQ
EEEKNSLCKSPRYLCQVCEDNGDLMECEGECHNYFHKSCVSENVEEPFKCEECKSGVHTC
FACKEKDENTKKCSVHLCGKFYHENCLNKLMHSKSDSNKGFVCPLHQCATCAIESSKKTK
ASKGRLLRCVRCPTAYHTGDFCIAAGSENLPGHNIVCSKHFQPNRTQKYHTHINVSWCFV
CNLGGSLICCDSCPASFHAECLNINPPEGNWYCNDCAMGKQPLYGDIVWVKLGSYRWWPS
EICHPKRVPHNIQEKTHQVGEFPVHFFGTNDYFWIHKGRAFGFQDGDKYSKETSKNKHLA
KIFARGVQEATEAFQALKALRADKEKMFIERSEKKPAPFKFVKNNIPVGSVVIPKPDLTS
IPRCECDPNSEAPCSSDTDCLNRMLMYECHPSVCQCGEKCHNQRFQRREYPDCTPFKTEG
RGWGLRTNVDIKKGQFVHEYVGELIDEEEVKRRIDESHENNISNYYMLTLDKNRVIDAGP
KGNLSRFMNHSCAPNCETQKWTANGDVRVGLFAIYDIPAGTELTFNYNLECLGNDKTKCN
CGAELCSGFLGVRPKSAVAASVAKGKKKDEKKKRKRNKKKIDGKKEHDDECFRCGEGGEL
VMCDRGGCPKVYHLHCLKLSKPPHGKWDCPWHHCDECGKPAITMCTECPNSFCATHTEGH
IKEVDGVAVCSEHDEVSSSGASSDAQSDDGGEDSNGQARTKAILKENLIRKRNLNTKQEE
EAGAGGSKKPRKQSVGESKKGEGKRGKSAGGNLLAVVPMFDDSDEGSDDLVIDIPAVPL
Download sequence
Identical sequences K1QRB4
EKC31425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]