SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC32045 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC32045
Domain Number 1 Region: 20-144,187-240,273-1086,1157-1346,1447-1683
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0
Family RNA-polymerase beta-prime 0.00000000803
Further Details:      
 
Weak hits

Sequence:  EKC32045
Domain Number - Region: 1076-1141
Classification Level Classification E-value
Superfamily HMG-box 0.00733
Family HMG-box 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC32045
Sequence length 1685
Comment pep:novel supercontig:GCA_000297895.1:scaffold890:46122:73210:1 gene:CGI_10014460 transcript:EKC32045 description:"DNA-directed RNA polymerase "
Sequence
MYVQGHLHKHADVINMEARVPRHVLRGISFNSYNSSEILELSVKEITNPQTFDGLLHPTL
GGLYDPKLGPTEKDDKCQTCGMGQGGCPGHLGHITLPLPTYNPFFFSVLYQLLKGTCFDC
HRLAVHSLKSAVLVQKFRLLEHGLISSVADVDEFATHFTSEYGNDAEEKILEQLNEIVLS
KINNTIEQDFHIKNVEACKNNTRRAFIHEHFTVKGKCVHCRTKRMPLRKVQNAKIMLSTV
TSSRTKKSTKPKQVKEKKDNDADDDEEDDDGEGEEEDDLESGTQIYLTSADVRDHLRQVW
QKDQQVLKCLFHFLSGSSADYPTDSFFIDVVPVPPSRFRPVSSLRDKKFENPQTQTLCNV
LKGAALIRKILSLKSTQENGKEITEIEPTAITEIPGKTLNEKLQNALVKLQVVMNCIVDG
DSDKLAVDKITGVKQILEKKEGLFRKNMMGKRVNFAARSVISPDPCISTCEIGIPEVFAK
KLTFPQPVTPWNVHELRQAVINGPDTYPGASLIDMPDGSKVILNKKEKVQREAIAKQLLT
PSPDPHQQNTCKVVHRHLKNGDVLLINRQPTLHRPSIQAHKARVLPGEKTLRLHYANCKA
YNADFDGDEMNAHFPQTQLGRAEAYTIACTDYQYLVPKDGTPLAGLIQDHMVSGVSLTIR
GRFFTRNDYCQLVYMALVDKRGPINLLPPALIKPKTLWSGKQVLSTLLHNIIPKGGQMLN
LTGKSKIPEKSWIHQQVRLASLDNMGESHVVIRGSELLCGVLDKGHYGNTPYGLVHCCYE
LYGGEVAGTLLSCLGRLFMNFLQQHRSFSLGVEDILVTPKADQRRKKAMHKSGKCGDEVV
TQALGLEEGTEGQELREAMMDAQFDRNDRRLRELDLCMKGKTDDTQNAIVGACMPKGLEK
LFPANNLQLMVQSGAKGSSVNCMQISGLLGQIELEGRRPPLMLSGKTLPSFLAYDSSPRA
GGFVAGRFLTGIRPQEYFFHCMAGREGLIDTAVKTSRSGYLQRCLIKHLEGIIVNYDMTV
RDSDGSIVQFYYGEDGLDVSKTGFLSPKQFPFLTDNSETGSKGNAFDKKVAKRMKKIKKW
NKSNKRRSKRCSAFLEFSKEFAEEHDLDNRTLEKTGRSKGATETIRSWQELEEAQKERYI
KNDINAPDPVTGVFRPFQYKGVLPESFLQKIQDFSKNELNKLPTSISEKGFLKLLCDKAE
SSYCQPGEAVGLLCAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLVEILMVASDKIKT
PSMEVPILAHCQDKAKKLQMKFNKVILSEVLEKVTVNEFLSVSNVSKSQRSRNFKLRFHF
LKPKFYTDRLDVTPSSILHFMEKTYIKNLLTKIKKKITDFQLAKMVNSGHIRPVLVTHTR
PAADEDDADEDLSDVEENDNTASDVKARQKKQEEQEYEEKEEEKEVLEEEENVEMDDNDD
EEDDEDKDSEEDDTLTSSVDRETSEHRIQFVVLSSSNIADYKYDIKRELWCEFTLQFGLL
NSKIDLTSLIEEHAKETVVHCVPGINRCLLKEVKSQQGPELHICTEGINILEIFLYADIL
DLNRLYSNDIHAIANMYGIEAANKVIIKEIKNVFAAYGIEVDYRHLSLLADYMTFEGTYK
AFNRRAIETCASCLQQMSFETTMSFLVKASLQGAYDNLKSPSSQIVAGKPISCGSGAFEL
LYKLF
Download sequence
Identical sequences K1QSZ8
EKC32045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]