SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC34767 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC34767
Domain Number 1 Region: 35-134
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000235
Family Pentapeptide repeats 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC34767
Sequence length 229
Comment pep:novel supercontig:GCA_000297895.1:scaffold596:19331:23631:-1 gene:CGI_10009569 transcript:EKC34767 description:"Periaxin "
Sequence
MSKKTRIMQSFWLVVVTIAVIHQCFSKTLDDVKLSHFFEEKLRFPKIKLPKVKLPSVNLQ
NIKIPDIDFKKMSLPKVDFSKIQIPNINLPSFDLSSIQIPSVTIPKMDFGNIQIPEFRIP
SVKLPKISFPKIDLVCGSQYVNSMKSRQAYLDKLKLLNSALESDFVYNVTFDEKSLNFLE
MSVNLISIDYRLSNSTARTYNATGEKFYLIDMIRSAEVLAPKLFQDFLN
Download sequence
Identical sequences K1QCY2
EKC34767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]