SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC37026 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC37026
Domain Number 1 Region: 913-1191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-69
Family Tandem AAA-ATPase domain 0.0000537
Further Details:      
 
Domain Number 2 Region: 672-911
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.99e-53
Family Tandem AAA-ATPase domain 0.0000495
Further Details:      
 
Domain Number 3 Region: 398-445,478-521
Classification Level Classification E-value
Superfamily Chromo domain-like 3.02e-17
Family Chromo domain 0.02
Further Details:      
 
Domain Number 4 Region: 321-370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000182
Family PHD domain 0.0013
Further Details:      
 
Domain Number 5 Region: 554-624
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000183
Family Chromo domain 0.006
Further Details:      
 
Weak hits

Sequence:  EKC37026
Domain Number - Region: 123-160
Classification Level Classification E-value
Superfamily HMG-box 0.0119
Family HMG-box 0.0074
Further Details:      
 
Domain Number - Region: 1730-1764
Classification Level Classification E-value
Superfamily Homeodomain-like 0.1
Family Homeodomain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC37026
Sequence length 2123
Comment pep:novel supercontig:GCA_000297895.1:scaffold425:997658:1029515:-1 gene:CGI_10026011 transcript:EKC37026 description:"Chromodomain-helicase-DNA-binding protein Mi-2-like protein "
Sequence
MAGKISRDEMDDSMDYEEEAGEDESFGDEASSEKKGKKRKKKDSEEKKKRKKSKKAKKYE
DDEDYGSGVPDEEEEEFVSSKKKRQKDRGGGSKEKKSPSDQIADELSINNVDIPFDDDDY
ISLNNYKLFKQHVQPIIQKANPKVAMAKMVTLIGAKWREFAQIVAQRNKDKDDGSPSERE
KGDTSRDGATSDKEEEVTDTENRDNDDDTEPHSDPVPEETSKKKRKKSKKTVPAIKIKIG
KKKRGRKKAASDDDGVGYDTSDEEFERQLEEASILEEEEKAAAEAAPKKKSKTKKGRGRG
GKKKTKLTNKYPTDPDADGYETEHQDYCEVCQQGGEIILCDTCPRAYHLVCFDPELEEPP
EGKWSCPHCEGEGIKEQEEDDHMEFCRVCKDGGELLCCDTCPSAYHVHCLNPPMKMIPDG
EWHCPRCSCEPLKGRVAKILTWRWTEPIQEEGKMEELDHTHPHLPASTRKLMNRKPLREF
FVKWHDLSYWHCSWISELQLDVYHPAMYRAYIRKNDMDEPPPLEDGSSYGGKDYKKQRKK
NRRRKDEEEEKEEEDDDSNLEEKFYKYGVRPEWLQINRIINHRQGKNETWYLVKWCDLPY
DQSTWEKENLDLPEISKHISQYEALRVLMMGDKRKKGKGGKRSRDGSEIQVKMPPSYPST
DLRKKWEKQPAYIDATGGTLHPYQLEGVNWLRYSWSNGTDTILADEMGLGKTIQTIVFLQ
SLYQEGHSKGPFLVSAPLSTIINWEREFEFWAPDLYVVTYIGDKDCRSVIREHEFSFEEN
AIRSGAKASKLKSDCQVKFHVLLTSYELISIDSACLGSVDWAVLVVDEAHRLKNNQSKFF
RILSNYKIGYKLLLTGTPLQNNLEELFHLLNFLSPDKFNDLTVFLDEFADIAKEDQVKKL
HDMLGPHLLRRLKADVLKGMPSKSEFIVRVELSPMQKKYYKYILTRNFDALNSKGGNQVS
LLNIMMDLKKCCNHPYLFPTASNDAPKLPNGMYEGTAMTKACGKLELLSNMMKKLKEKGH
RLLIFSQMTKMLDILEDFLEYEGYKYERIDGGITGSMRQDAIDRFNAPDAPQFAFLLSTR
AGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRNSVEERITQV
AKKKMMLTHLVVRPGLGNKGGAMSKQELDDILKFGTEELFKDMSERKEEEEARIVYDDEA
LDKLLDRTQAGQEEREMAMNEYFSSFKVATYAFKEEEEEEPETEVLKQEAEHADPAYWEK
LLRHHYEQQQEDMARTLGKGKRIRKQVNYNDGMTGHGDDDTWKNNFSDIDSDFSAATDND
EDDDEYEDSEKNKRGSRQRGSEKDRPLPPLLARVNGQIEVLGFNARQRKAFLNAVMRYGM
PPQDAFNSQWLVRDLRNKSEKVFKAYVSLFMRHLCEPGADNAEAFADGVPREGLSRQHVL
TRIGIMSLVRKKVQEFEQINGLHSMPYILATKALELMKKEAVSKSPAPKSPAPGTKEEES
DSKKSEEGKDKAEDKTDEKENSEEEEKKTEDKEEVKSEEKEEIKKEEVKEEEEEKAEEKK
EEEKKEETPAVKEEEPMETEEKKQEVKEEKEEKMETDEKKEPEKEADKEEKEEKSDSETE
KKEKQESSEETKDEKESKDENEEKKEEKSDEKKEEKEDKSEDKEEKKTPEEEVKSEVKDE
KDKEDEKKDKEDEKKKEEGNQKFMFNIADGGFTELHTLWTNEQRALQPGKEHEVWHRRHD
YWLLAGIVTHGYGRWQDIQNDHRFQIINEPFLSEQGKGNFLEIKNKFLARRFKLLEQALV
IEEQLRRAAYLNLTQDPNHPAMALNARFAELECLAESHQHLSKESLAGNKPANAVLHKVL
NQLEELLSDMKQDVSRLPATLARIPSVSQRLAMSERSILSRLVNPGQAAAQSTTPATTAS
ASSSSSSSHALPSTTAAFLAQAGLPAGYSAANFSAGFRPQFGLPQSPFGQGPLGFPLIPN
MPSQHDISTTISAILSQSGQLLGQSGAMKSSATPSPSHRSPASTPGPPTYDQATAPFLPS
PADPFTWQVSAESAAKSAMESLLGQSLAQTKAGVACLLCPSDYGQKKEGGVCEGLVGGGW
GDDQALVLLCSMEVNSPKQGQRK
Download sequence
Identical sequences K1RRH1
EKC37026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]