SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC37833 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC37833
Domain Number 1 Region: 162-251
Classification Level Classification E-value
Superfamily HMG-box 0.000000111
Family HMG-box 0.0082
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily HMG-box 0.000000458
Family HMG-box 0.0038
Further Details:      
 
Weak hits

Sequence:  EKC37833
Domain Number - Region: 103-159
Classification Level Classification E-value
Superfamily HMG-box 0.00511
Family HMG-box 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC37833
Sequence length 293
Comment pep:novel supercontig:GCA_000297895.1:scaffold378:382174:383055:1 gene:CGI_10017656 transcript:EKC37833 description:""
Sequence
MANLGKMWNSLPENEANMYKFKAKELQEKYKVAKAEWEARLSPLQEEALLHQKEEHSEAL
KKRRLKKVFKETEKPERVKRVLAINLMDIEDVDVPEGGNQKEKFTRQVQRKTELWNALPE
NEKEALKEKAKLQNKNANVNYEKKLASWVQNMFDEHRMDIVTKPETKVALEQLGMPSRNK
AALQLFMMSELGKEKGVTVGTAKTIFDKLSNAQRETFSHQAMEDKEKYQQEWQDWMGKME
SKGLKSYAEALLGKSRAKHTAEKVGRKSTSKGKKKKGRGKKKSTKKSPKKSST
Download sequence
Identical sequences K1QVZ2
EKC37833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]