SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC38002 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC38002
Domain Number 1 Region: 158-238
Classification Level Classification E-value
Superfamily HMG-box 2.09e-22
Family HMG-box 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC38002
Sequence length 1283
Comment pep:novel supercontig:GCA_000297895.1:scaffold369:46444:54103:1 gene:CGI_10006950 transcript:EKC38002 description:"Transcription factor Sox-8 "
Sequence
MEQRIKNGFSVYNNDNTQKPTMVKYFYFDKDGRQLSEEDVQKLKINVKGNVVLSSGLAGA
PIDGNFLDSQGNSFENGTRKTTPQQTSVIKTEPVRQRSVIPNFQASHNGQIYLVTPDGGL
RPAEESSEIKTEPDDQEKKNTTEKVMPGTNIEYRNRGTNHLNRNGKIKRPMNAFMLWARE
FRGRLAEQMPNASNAEISVGLGQVWANLPTPEKQHFYLEAERVKNQHRRDFPGWIYQPNI
TKRQNSKDSQHARMWQRFVTNKEADGKEQGMETKFRPIAPAPPDSQSSGNISTKAYSTGT
EDDKLSPPKSSVKIGDSQMSNEVKSNTMTLDEQKHQQDSKIDAQTIQSTVKQVIVSSSSQ
QRVYNHPLPVSTFKEFKQDVMSSEQLKNTATCVHNGPQLQTGIRKDVAPIMSTHTQPAPV
SRSHMMYRDPVAMAATGTQVDYTRGFSKQPIPVPGYQTARPGRPTSYGLKYDYTPLSKIS
SFVPMTRPRVSSTVVTPSTGQVNQQPPQKLLTQETLGAHLPVNQTMLNQFAPHQGNETQQ
KTKQAVHQMTANESHSPDDLQQPIAIPTLPNLPDKADPLWPFPFPGVEQGPQTHLLYQGN
VPETPTKSVLSDPYAPFYFDNYINPVRPTELQVDVNGDAFSPFDRWQQYLNDDHTNAPIK
QTASYFPTVKQCPSDIEICPSPASHTLSRNQIKPTSSGTELSTSTCSDRLINTSNTAVLQ
EVNTNQQQGCSPSIEKLSCPSTSQESMLSDNQEKQNQMVVIQTTGNNQRVAEENEIHITP
LQTPSGHHIGTMVQNFGNNEVSINPVHYGGENIYQCIPQPAPGACPRSQGKGVEFGSVMS
SAFHAINGDLETFENNLEKYPLPGYSETVSCIYPQHDVPQYVQPSTSSENFQMISKYQDE
NNRPIKKRSYKIIEGLLENEVWTTQNRPMKTVSATEQSFSDLEFKDDAKASKSDDELLRK
GKITKDQEQVQSIEEDEDNTNAQEPMVERNDMIHCHINELLETNSETETNNTNIQEQKNS
TAANEDNNESPPIRKEVDLQKIDQEKKGDNSGEDTVEENNQENESEDEFLSGNIDETEVS
KVNTETVTCEENFENKCPEIVVKTEADDETDEGTSGYSEVAESKEELSKIELVIDNAEVM
SLSNCEEQYLISNDTSAEISGEMENQLHQLSKPQLSEILEDESSSEIDKQNTSESNHQYE
EIFKSVQLVKKNKTKYTILDSEKSCEETKHHLDYPNLESGDATANVKRVALEEEEPLPSF
VKSRNKRRQPYDSPVRASKRLRN
Download sequence
Identical sequences K1QMF2
EKC38002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]