SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC39890 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC39890
Domain Number 1 Region: 10-296
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-46
Family WD40-repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 233-326,459-613
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000000549
Family NHL repeat 0.038
Further Details:      
 
Domain Number 3 Region: 924-985
Classification Level Classification E-value
Superfamily HMG-box 0.000000969
Family HMG-box 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC39890
Sequence length 1015
Comment pep:novel supercontig:GCA_000297895.1:scaffold219:239010:254476:1 gene:CGI_10016622 transcript:EKC39890 description:"WD repeat and HMG-box DNA-binding protein 1 "
Sequence
MPSCSPLRYAHSEGLTSLCYDDKGKYILTCGSDGDVRIWEGAEDDDAISHGTGDKAFCVA
YKNDRFYIATDANTVQAYTFPGGSPDGILARFTAPANHICINQMGTTLVAGSSDFTIKLV
DISSGDTKKFEGHEAPVLSVALDPKEEFLASSSCDGSVVIWRVENKEKVKKFQILPKVGD
ISLTKGLCRLCWEKNGQFLYVPLENEIQIYNRNSWSTTGSIQDSQFSGVYSVLDLSPDGT
HLAAGCYDGHILIFDLKTKTCVDRFKHESGLSIMSLSWNPSNQTEIAFCDREGQLGLLSE
INLKGGNQPAKEQRVKETLGIFEDDDDDAELVQASDEPSKEQIFDEDSNDSTPASVLKPL
DDDLASEDGEAPPVIPVQTRIIERPGFVPTPPQGAFQPGSTPKHLSSRFMMWNAVGIIKQ
FNTEEEESIDIEFHNTAIHHAMHLTNSAGYTMGDVSTEAVVLASPGEDSDPSKLTCMHFG
SWDNSKEWTIPMDDGEAIEALAIGEDWIAVATSGRLIRIFSLGGIQRDIFSIPGPVVCLS
AHTNQLLIAYHRGMGLPGDQCLGVHLMTVEGATQINHQPLPLSHKSSLAWMGFSAEGTPF
YMDSSGIVRMCNRRFGMSWVQVANTKSHTKGKSDNYWIVSVHENPQQLRCIPCKGARFPP
VLPRPAVGILPFQVPLCQMNTEKSQYEEVFHRTQLLSSHLQFWNTIGYEYDTSIASELAK
PSQEALMKLFALSARSDREFRALEVCEMMSEPHTLQLAIKYACRLKYMQLAERISEVVQR
KSAEQAEEVEEEEEEVVHRVQRVHNHQNHVQEDEEMEEEDVEVDQENAETNSAGGPLLNL
KAKSKNEVLSQSYGSSGRSNPFKVLTPQKPEPTKGTQVFDGMSKKKQTSPGQVMLKNTRP
VKAVKRTPQSQGKITSVKSTNEEDKQEESQKKSKSAFDLWFEETKSQLMEELPEADEESL
VQTAAERFRKIPKEERQIWIQKSKEGDNKKRKREEEEIPTRKVNPKLAGFAFSKD
Download sequence
Identical sequences K1REU2
XP_011416613.1.10878 EKC39890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]