SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC42172 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC42172
Domain Number 1 Region: 392-464
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000445
Family HMG-box 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC42172
Sequence length 627
Comment pep:novel supercontig:GCA_000297895.1:scaffold77:92627:103108:-1 gene:CGI_10027966 transcript:EKC42172 description:"HMG domain-containing protein 4 "
Sequence
MMASKRKREDDFEYAPSSAKMSKNEDSSSVSRSGRARKKPARFLDQVEGDEGSPETQEVE
TKPVPVEIQVLKSSPNLLTAPPQIISSTPQLIMAAPQIISADSQLISNPTQLISVAPQSV
RKKSAKVIEMEEFEKAEKVKSTKKTPKVGSPEFSTLTASTAAGGIQPQILQAANIQLNLM
NALNTSTSTDVQSSLLAHLRKNPQLVRVVDDQKLGSIKTEPMLVSGPFVSPGEAVMGDQI
GSVKDEPIDTVDPNILLPQSAPGSALLTHLTKMAQQEGNVSPTKSPPKKKTPKAKTVKEE
PVTSMAGDSQSKSVIKMLLNKPAQFSEPVISTQTLSQINSPVSDKNVKKPVRLKLSTEST
PVSQIGPAGDASYGHATPTAITGSMDTGRPSTSSVGMDIKKKKEKKRKRLTAYTMWCNSV
RYKVLNENPGIDFAQLSRRLGEIWQSVPAKDKMAWKRKAKREARKLLGKGLLITTGKGGG
SSQSQTSVSGAQAVPSSSTTPPPIYHPPIRHHSGKHHSSNNSTATVSAAKLQEDQSGSPS
KMLGIDPIDTAAHLKLVGDSLSIIGIRLQEHRGLIAVQGSLSVLLDSLLCAVGPLMCLTT
QVPELNGCSAKTHTRVLDNIAYIMPGL
Download sequence
Identical sequences K1QYU1
EKC42172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]