SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC17973 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC17973
Domain Number 1 Region: 224-504
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.66e-58
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 22-220
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-33
Family Pleckstrin-homology domain (PH domain) 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC17973
Sequence length 510
Comment pep:known supercontig:GCA_000297895.1:scaffold44098:293822:315160:-1 gene:CGI_10017713 transcript:EKC17973 description:"Src kinase-associated phosphoprotein 2-A "
Sequence
MYTANVQDIHLSFKMTSFHESIKELISEVEKFLVETIKKEALSKTSKEHKQTILDKIGRL
REEFPQFTPDKQSEDTKSADQSFTDESSRTGGSSNADDEDQYGDSNIPAIPAQDLTDTIK
CGFLEKKQRKGGLFGGPKLQKRWCAIKHNIFYYYESAKERKQHGAFYLNGYYLEAAPEAV
DKKDSARRELSFQLVCPAKRTYQFVALSKEDYDDWKVAISKGALSSSSRENILMNDISFG
EEIGRGAFGTVRKAEWLGTEVAVKEILVIRMKLAKPLIKHELAIHSTVRHPNIIQIMAYG
LENNKLFMVSELNNGKNLDDVIFGEEYENKLSYDTKHYIARNVLQAVAYLHNQVPAIIHR
DIKPENILKSDDLKRIRLCDLAISKFKTMNTIMVTTSDGTTRPGTPTYQAPEVLLERRSG
HVYSDMWSVGCTVLELFLEVPAWSVPVDTDPVAYIVGCMKEKIQPDSLQDFATKFCQKSR
MVELVNSCCCYDVKTRPNALEMLKGFKQNL
Download sequence
Identical sequences K1P942
EKC17973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]