SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC20942 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC20942
Domain Number 1 Region: 98-183
Classification Level Classification E-value
Superfamily Second domain of FERM 1.28e-25
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 2 Region: 14-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-24
Family First domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 207-354
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-23
Family Third domain of FERM 0.0017
Further Details:      
 
Weak hits

Sequence:  EKC20942
Domain Number - Region: 449-530
Classification Level Classification E-value
Superfamily Tropomyosin 0.0219
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC20942
Sequence length 631
Comment pep:novel supercontig:GCA_000297895.1:scaffold41380:37229:64177:-1 gene:CGI_10005040 transcript:EKC20942 description:"FERM domain-containing protein 3 "
Sequence
MFRKKSVKGDVHTELQCSVRFLDDSEPQSLSFKKETPGQELFDQVCNKLNLVEKDYFGLR
YVEDKQRYWLDPLKSVYKQLKGVNPCVLCFRVKFYPTDPMKLHEEITRYYLFLQLRRDLH
HGRLLCSQADALVLAAYIIQSEVGDYHPEDHPQGYVSEFKMLPKQNAKMEAEIMEIHKSL
TKFSIHSHNLHNTLYCGIIRFRGGSIFVEFDQKGVSLYLGVTHQGIMTFHGSRRTQLYKW
SQVKKMPTYEGKTFILHVNMAEDGDQANNRKKQKPIGYKCDTLAACKYLWKCAVEQQLFF
TLKESAHPPKLRSGHSLFSRGSKFRFSGRCQHEAFAASEDIKRNEPNFNRSSSLPNYGRK
PDSKTSPNKHKSLVLDIPIKEESAVDVPKREPAKKIEVVQPATTIAQVTAPVATPEDSVV
SEIVEPEKTTSTETEPPKQNGSIPTVVLNSGNDEIPPYEPNFTVIEDPSPVKEDSVQRAQ
PDSDDDEDEVEENEAKKTSLEDQIKDLEEEIERKSSFSGSYQPEENVQEETVIKETVVPK
ASNNVQSTPNSENHVGNSTKSVTEEPQSGGGGCCRVFLLTFFFIFLTLTVTAIALLNSSL
DHPLLTQLRQHVQFLNPARDYVMHRMNSFMS
Download sequence
Identical sequences K1PAW2
EKC20942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]