SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC21172 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC21172
Domain Number 1 Region: 11-244
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.2e-70
Family BAR domain 0.000000593
Further Details:      
 
Domain Number 2 Region: 293-348
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-22
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC21172
Sequence length 352
Comment pep:novel supercontig:GCA_000297895.1:scaffold40820:55979:68758:1 gene:CGI_10004477 transcript:EKC21172 description:"Endophilin-A2 "
Sequence
MSWEGFKKQFNKANQYMSEKIGGAKGTELDEEFVEMERKIDVMGKLIDDLIGKTQEFLQP
NPASRTKMMVVNNFSKVRGTTKNVSYPQPEGTLGEHMIKHGKDLGEEMMFGECLQEAGEV
FKQLADHKYALEDNVKQNFLGPLADLQSKDLKEVNHHRKKLSGRRLDFDCKKRKKDKGAN
VTEEEIKAAEEKFEESKELAENAMHNLLENEVEQIAQLQSFIEAQKEYHQQAASLLDDLL
DNIDRKRNEAVSRPRKEFIPRSTSRVSATSNHMYDTADSYNFNNSPPTTKKEACAKALYD
FEPENEGELGFNEGDMIKLISQIDENWYEGSLNGRTGFFPVNYVEVVVDLPH
Download sequence
Identical sequences K1PBJ2
EKC21172 XP_011450011.1.10878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]