SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC21661 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC21661
Domain Number 1 Region: 61-138
Classification Level Classification E-value
Superfamily HMG-box 3.01e-22
Family HMG-box 0.00089
Further Details:      
 
Domain Number 2 Region: 496-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000274
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Weak hits

Sequence:  EKC21661
Domain Number - Region: 252-343
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00262
Family Formin homology 2 domain (FH2 domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC21661
Sequence length 591
Comment pep:novel supercontig:GCA_000297895.1:scaffold39720:37035:47449:1 gene:CGI_10003516 transcript:EKC21661 description:"SWI/SNF-related matrix-associated actin-dependent regulator chromatin subfamily E member 1 "
Sequence
MALPNFRSIQQTPPPPASRSRGYDRNAPSPFVPSSHGHPAFNPVKVSSRGGVSNHFQGDT
RGPKQPKPPDKPLMPYMRYSRRVWDSVKAQHPDLKLWEIGKIIGQMWRDLSDQDKQEYMD
EYEMEKSHYNDEMKKYHNSSAYQSWVAAKGKAAAEAALEEDEKEKNAQRTPRSAGSSKSS
KMDSVGRISIQQADDDDDGDDSFSVKHMAHSRYLRNHRLINDIFSDTVVPDIRTVVTTSR
MGVLKRQVQSLTMHQKKLEAELQTIEEKHEAKKRKFQEASDSFHEELKNLCENKPQVTEE
QFNAMVVKAKEDLKVRHQQYLQQQEEERKKQAELAEQRKKEEEERERIEAEERERLAQEA
KEQGLSVDHNQNAQGGPTVLQNILTDGSVPETLTNPEDEVEGDLPDNADAESMDSEKTED
MSQDGMLGMEGFEKEGEDPLYSPSPDSPTTSPDMLAHDKSMDPMDSPESQEDATPKKKKK
NRSKKEDKDKKERGEGPRKYPCDICGKAFKHKHHMTEHKRLHTGEKPYSCTRCGKRFSHS
GSYSQHMNHRLCKPSAKGKKDPDNPPSVEEEDSMDSSIDERTEEATGKGDK
Download sequence
Identical sequences K1QJ62
XP_011415801.1.10878 EKC21661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]