SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC23173 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC23173
Domain Number 1 Region: 111-179
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-19
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 2 Region: 15-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000241
Family First domain of FERM 0.016
Further Details:      
 
Domain Number 3 Region: 186-269
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000646
Family Third domain of FERM 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC23173
Sequence length 869
Comment pep:novel supercontig:GCA_000297895.1:scaffold1900:220330:234356:1 gene:CGI_10017336 transcript:EKC23173 description:"FERM domain-containing protein 1 "
Sequence
MSSLSLHNAVSKKKKVVNVILLNGEACQVTVDVKSKFLDVFNQITSYLNLRETEYFGLAQ
KKDEEYLFVALDEKIHKQAPKSWKTGNGEGLDERGQPILTVYFRVHFYVDQFVLLREKVT
RHLYYLQLKENLLHYNHVCSEGKCFQMVSYALQADLGNYSSEKHAEGYFDPREYFPAWEM
SDSFKNLISTFLWPDIGKLHFEKKKFEIQSGPGGRKFSYYTESDCKSKYLLSLCRTTHMF
QMAIQPKLMEIRHLDAEDKRRYRESYIYSDTQDLVTNGGTFRGNLSPSTKGATTRFSVVS
DASSNTTSGIASDKMTISFEENDEPTKEIMIDCPPQVSNFRMSPRQGRLTADGVISTLPS
YIPSRGKKTSPKLDYKSASVGRGMKHIDRSPSLGRPTIPKPSTSPVTRHIDRISPTATPV
ISAHRSDISAHSGHSAHSTHSAQSSGTMFNSSEHVNKSPSGSSFGSLQGGRLSLPCPPQP
VPPAYTSARTVPVYVAHSTTSSFSHSDAISFSQPVSRSTSRAESFNKNFGRYHLQENESL
IPPVSSQLQTPFTGTLAPDFGSGTPLLDALAGNLVLQNYQNYPPVTHGEMTEVPYPKPEI
TEAYIPNTEMTLPEMTKEYLAPPPMFADSSHNESTDSALSGSGSMDPKLSMTSDSGSMDH
TESEVEESNQDGELASENPPTQISVNNQEEILHPELEEIRGQPSAFSSFSMITKLCTDKS
LMQNPYPKVSVPVIGAYDMSSIRSTDSRISHLSHDMDARRLSSCYPESSQPMTTVTPTRP
FSWHSENFELDAQLTLLNGNVAMIPGYLDNCTSMPQNLGGILVAPPSSLANTFALDFARQ
QMIGGRSMVKVSSKCNDGTDVTMVNEQFK
Download sequence
Identical sequences K1PNE2
EKC23173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]