SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC23398 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC23398
Domain Number 1 Region: 45-111
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 
Domain Number 2 Region: 120-162
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000628
Family Hairy Orange domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC23398
Sequence length 404
Comment pep:novel supercontig:GCA_000297895.1:scaffold1889:356127:364951:-1 gene:CGI_10019616 transcript:EKC23398 description:"Transcription factor HES-1-B "
Sequence
MSHRTELASATRRSWKPSTVKTRVRHDLFCEIAEGKSRKMSPEKVSSTTSPNRKSLKPVM
ERKRRARINASLAELKSLLIEVIKAEGTRQNKLEKADILEMTVRHLKTVHKNKTTDGKEV
SRINKYRLGFSECASKVSQYLENTDGVETDFRSRLLNHLTTVTMSSDQDSENSDSQIPLM
PNQQMQDRIRQARPNQNITANVDSTNSVMTTNQSVETQNEANQRVNGKTCNAIEWSSVQN
QNNMASNLVYNTQSANVSAASGQVAYLVPASGVLQYNNAPVPCSNVFIRLVQPININTSP
APCRSPFVVTTSSSSPAYVNQPTIANLQPEQKLTFLPQTVPRINDRVAFESTDSVQRLNN
LTSHLGQNKTTFSLSSTQFGQNDSDITKEITSKESKGTDMWRPW
Download sequence
Identical sequences K1PP05
EKC23398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]