SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC24552 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC24552
Domain Number 1 Region: 552-827
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-81
Family Protein kinases, catalytic subunit 0.00000000905
Further Details:      
 
Domain Number 2 Region: 1139-1271
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.7e-43
Family FAT domain of focal adhesion kinase 0.000024
Further Details:      
 
Domain Number 3 Region: 268-390
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-42
Family Second domain of FERM 0.0000206
Further Details:      
 
Domain Number 4 Region: 173-267
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-29
Family First domain of FERM 0.00029
Further Details:      
 
Domain Number 5 Region: 391-496
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-25
Family Third domain of FERM 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC24552
Sequence length 1275
Comment pep:novel supercontig:GCA_000297895.1:scaffold1788:491493:510949:1 gene:CGI_10019934 transcript:EKC24552 description:"Focal adhesion kinase 1 "
Sequence
MTTSSTTSYPVGDVGLPHLVYLTHEGTLTSICTHRPVLQSYDTDQTSTQRCWGWLYSCCC
CHFNRTMKLSHAKGISKRLSEVYRSFWFPCTVSEDVHSRELTTVGLWTLLGDNPAIGMIL
GCFCPTCYEENDEIARWSRLWKIIQDEECEQCSDLIEAENESDLRVKRFLMDRSILKVHL
PNGGFNMVKYGDATDVKIMDIIKLVVGRLAAGERYYSKCYALKLVHLQSKESYWLHNNLS
MYQVRQKYESSHPPEEWRYELRVRYLPKNFSDLYLRDKVTFFYLYDQIRNDYMRDIAESI
EPEVAIRLGCIEMRRFFKDMPQVALDKKSNFEYLEKEIGFKRFLPKSVIDSMKSKNLRKL
IQNHFKQYAQLKEHECVYKFFDTLSTVNKFNQERFRCNVGSTTSWGISMEIVIGPEVGIS
YQTEKSSSPVHMADFSQVKSIQTTTQEDRGILQIRIAGAVDPLTITSSPSEVEDMADLID
GYCRLVHDINTSLWTRKGDSIPRTPKSSMKKSGQKDAIHHERISDYAEIVEDEGDYSTPA
GPLGSRRRKKSRNFELKRENIKLLEVLGEGQFGDVFKGLFTDKDGVQSAVAVKTCKEDNE
DSMMEKFLEEALIMQQFDHPHIIHLVGICSETLPVWIVMELAKHGEMRAYLQNNRTRLDL
CTLMLYCHQLSKALSYLESKKFVHRDIAARNVLVSSHDCVKLGDFGLSRVVDEQSYYKAS
KGKLPIKWMAPESINFRRFTTASDVWMFGVCMWEILMYGIKPFQGVKNNDVIGKIENGER
LPLPQECPPSLYNLMCQCWSYEPSKRPSFSDIKVRLQEILAEERNRQVEEMKRDNRRIQE
INWTGSSGSDIEEPPPKPARPNFMTPAGSTPNLSNNHSVDSLPPQWGSTTHLPISHSTPL
GPSPQQPPIHSHTGPPVMSVIPQHQGPREINLQNYFPSSSGYTSVQQHQHYLHQNSESVP
DMGRGGAGYPGYNVPRNPQQLSEMLSTGQRNAPPSPVNSTVISDIMTQNPHSNHASPDSE
WAPAVTVPVRLLNDSEDTTVIEQQLRLQQRQSEEDAKWLQDSEKHLKRDKSSGAIEQETR
VQNNRSPTDGLPTQKENPQIPPHPNVVTRVPSHTSSGSRSSSTSESDGLSSPRQPELPDL
DRSNDNIYNSTTSVVRSVMVLTKEASNVKAEEYTNLVKDVGVKLRALLGAVDEFIPTLPA
PFVHEVQMAQNVLSTDMASIIAAMKLAIQYSTTTMDVEYRKGMLKAAHVLAMDSKNLLDI
VDKTRVKVKLQSGLS
Download sequence
Identical sequences K1PKI5
EKC24552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]