SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC24704 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC24704
Domain Number 1 Region: 181-330
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-36
Family Third domain of FERM 0.00039
Further Details:      
 
Domain Number 2 Region: 82-183
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-24
Family Second domain of FERM 0.00026
Further Details:      
 
Domain Number 3 Region: 6-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-16
Family First domain of FERM 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC24704
Sequence length 1298
Comment pep:novel supercontig:GCA_000297895.1:scaffold1771:44267:58058:-1 gene:CGI_10004385 transcript:EKC24704 description:"FERM, RhoGEF and pleckstrin domain-containing protein 2 "
Sequence
MLVNLQTNENYIKVKAPGLSLWEAAVYHLQLVECDYFGLQYEDSHGLKCWLDHDKPILKQ
LPSPDSPLEFLVKFYTPDPGMLDEFSRYLYGLQIKKDLANGSMVCSENTAALIASYIAQA
EIGDFIIEEYHDHSYLSMLGPFVPNQTEEMLKKVAEYHKQHIGESPAEAEAGLLDTARKV
ETYGMKLCPARDHEGVILSLAVAHLGILVFQQFTRINTFSWAKIRKLSFKRKRFLIKLHP
ETYVSGQKGYYKDTVEFFFDSRDCCKNFWKKCLEHHAFFRCHRIKPVPRNKTRLVSHGSS
FRYSGRTQKQLMSYVRENPVVTPQFQRSVSGRISSSRSTSVTPKITAKAVIHTTPDTTNS
MGSRGSHTAGSDRVVSPTRSDHNDSHSLDSSLSGSRSLHSPRLDGGHREGTPGVDDYQEN
EDEAVRGARLLVTNAECLGTNSHVSSANQNVHDNGNLASVDADISGGGGGVNGGGSNVVC
TNGGAVTVNNSDKSVGGKSGDTSPSHDNTGVVTHLKDSRRVMFAEDTKSSSSSSSSSDFP
TEQKQITSQAGKFMITLKEEIPAGTCITVSMEMSPVKEVPDSMEESENSVNGDRTDHCVV
RANSEVQESADLYEPSAASGCVETGSMMETSPHGASPEAEKSEISSPDDLIEDIPYYLER
RLYDNGVADKQEVKSPPFVRRGRSSTKRRPTNMQIEHVKVYEGGSQSRNESPASGRSLSR
DKEASKSMSPVGRSVTSRSPSTGHRYTSKSSLERSPSCNRKVEIVNVHKLPPRDSYSSVD
DTTSPTMEKDVIRHIQSRGILGKSLSFRGEREVRTRTPNLNKSSSFHGEKDLKTKIPNGG
ATFIDELHRKVSEIGDQKADKSKLETNPCESEKMKTEKGEGLSSVGNNNGGQVPDPGTVE
SVGDLCGESSVGLKLTDSVSLCGSDRVSQGMDLPSQAAAYLILNKDPPARKPKLKNITFS
TFKPMDDTTAPGCRPSSVVDSETDAKSDYGSLPSAKHADSKKPLQIPVQPEAMLFNPTNT
KVVPAEVEGKKMDRFYGPLRPRKVSFHRERGYKYSFESVNDPPAFALAEPIEDICLIDTT
DRGPSKSPSTDVLDILEGLEDAELVESDTSESCTSSLDSDGPSDHSSSDEESHKHDEFLI
FAKSLADSGKETTKDSGVGVDEGPVRSLSQDDPASDGKRGTKKPSQEKVDEREPPNRRTL
VRQSPTDSSLSSIESDSDPDLSCKRHSLDPLDDLENPSIAEVNTSFSDSSSDGEREEGQK
TGGGFVIPTLTFSLPSSPDASSGSPKENQDNEFGSTFC
Download sequence
Identical sequences K1Q035
EKC24704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]