SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC27003 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC27003
Domain Number 1 Region: 11-90
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.000000445
Family Rap30/74 interaction domains 0.00068
Further Details:      
 
Domain Number 2 Region: 146-180
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000101
Family DNA-binding domain from rap30 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC27003
Sequence length 188
Comment pep:novel supercontig:GCA_000297895.1:scaffold1503:187320:192498:-1 gene:CGI_10009538 transcript:EKC27003 description:"General transcription factor IIF subunit 2 "
Sequence
MRITRSRFPGQKPKVTFTIDEELAKGPPGEMPIPREHNMILTGLGNQNLVVFSQTPVTVK
QESSSGSVDVVASDRIAVEGKVIQRADCQPDKTISYMNLKRKQLEIKNKPQREVIQITKV
VPMYKPVNNHVHNAPSSDKNKVEKRLREDKEKVMDILFNAFEKHQYYNVKDLVTLTKQPI
IGRIVFAV
Download sequence
Identical sequences K1PZD4
EKC27003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]