SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC28180 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC28180
Domain Number 1 Region: 179-441
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-82
Family Protein kinases, catalytic subunit 0.000021
Further Details:      
 
Domain Number 2 Region: 27-145
Classification Level Classification E-value
Superfamily PH domain-like 9.33e-22
Family Pleckstrin-homology domain (PH domain) 0.0000749
Further Details:      
 
Weak hits

Sequence:  EKC28180
Domain Number - Region: 443-485
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0014
Family Protein kinases, catalytic subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC28180
Sequence length 542
Comment pep:novel supercontig:GCA_000297895.1:scaffold1327:376430:386645:1 gene:CGI_10014348 transcript:EKC28180 description:"Serine/threonine-protein kinase D1 "
Sequence
PNESNNIPLMRVVQSIKNTKRTISKTIKEGWMVHFTNLDPQRKRHFWKLDYKSITMFQQE
NSNRYYKEILLMDIISIEMSKMRAPVSEISKAPHVFEIRLQNITYFVGEDPTFGGREGDF
LVSPESGTGLEQARYWEHSIRQALMPVTPTSSITSEGQTTDNGNVSEDDPIQKDIYSMYQ
IYAEDVLGSGQFGIVYGGKHRKTNREVAIKVIDKLRFPNKQEAQLKNEVSILQNLHHPGV
VNLEKMFETPERIFVVMEKQKGDMLEMILSSPKGRLSERITKFLISQILMALKHLHSKHI
VHCDLKPENVLLSSETAFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLKDKGYNR
SLDMWSVGVIIYVCLSGTFPFNEDEEISDQIQNASFMYPAMPWKELSQEARDCINVLLQT
NHKKRPSCSKVLSHPWLMQISCLLAAIDLISNLLQVKMRKRFTVDKSLSHVWLQDYQTWC
DLRQLEENVGQRYLSHESDDERWEQFRKEKNLGRWQDIGMKGVNETYKYGKWRSDRTVNA
SS
Download sequence
Identical sequences K1QH84
EKC28180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]