SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC28741 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC28741
Domain Number 1 Region: 354-529
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.6e-26
Family Nuclear receptor ligand-binding domain 0.0009
Further Details:      
 
Weak hits

Sequence:  EKC28741
Domain Number - Region: 572-612
Classification Level Classification E-value
Superfamily Plexin repeat 0.00628
Family Plexin repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC28741
Sequence length 741
Comment pep:novel supercontig:GCA_000297895.1:scaffold1258:632490:668544:-1 gene:CGI_10023509 transcript:EKC28741 description:"Plexin domain-containing protein 2 "
Sequence
MTFTKGQKSDVAYSLFEGDAHLDSVISFNSHHTLHRRQSGNDNTTSSPTPTGGTTPEFTE
QEVSQNHKYYTSTVLRGAADFNSYWDELYDVKHSEPLSGSHRVAVSVPINFNFRFYGHDV
SKITIATGGFLYMSPFLHQWLTATQYIAPLMANFDTTLGNESQVLYKDFGHKFVVEWRDI
FLQDQNHTEPFSFQTTLHSNGTIYFAYKQIPVEIQSIEKKNHPVKVGVSDAFYIDTIYAV
KSQNGSQHRYSDSNEDETERKARMQKVAMNRQMKQKHPQVGEIIIKQEPVSISIEATSSM
PDTQSGGDEKTTFPTVAFGNSQPLILPTLTPDTVPKDPKMYRILKTEEKMLVEELSVAYV
ETLGGFANETHVNKEESYSSADELVNNSEIAVRRLIKFVKKIAQFRGMSQENQVACLKSC
VLNALLLRSVNFYDAENDAWKTPTGSIPTSVLKHATGFNDLHDAHTSYCAGLKKLTRDDS
NIMALIQTITVFNPDGQNLENRQTISDIQDQFIQLLRHYLESEYDFFSHFSVLLTRRLNE
GVQRRTIYEYHRVEVDFTRIQSNSVVILEPLTTCNIAKDCFTCLSQDDNFDCKWCQKVRR
CSDGIDWLRQEWRDQGCEIQGFDQLSRCGMTSTSSVPWTTKRPTDSIQPDCSSSRSNCSY
RESQKGASNATIAGVVVAVLILVLLIVGGVWFFYAYTHPTSASGQWMINHRPSEMKAKMN
KMKFWKRDTASGEKYRVESTA
Download sequence
Identical sequences K1R4B8
EKC28741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]