SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC29919 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC29919
Domain Number 1 Region: 58-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000103
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 251-315
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000251
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  EKC29919
Domain Number - Region: 133-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00034
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC29919
Sequence length 342
Comment pep:novel supercontig:GCA_000297895.1:scaffold1143:77238:82579:-1 gene:CGI_10009137 transcript:EKC29919 description:"Hemicentin-1 "
Sequence
MDAMEYQAFLPDGYNQMLYSNTINLHVLGEKPFLNDLEVTTEDEEIKIHYSFGVSENSPH
VQDIKWSKNGHRMDIGYDKFIRGSLHDSCLIIKSPSEDDKGKYSCTVTNAVGSKEKDIVL
DVPCIAISTKPKVHFASDTTITSIVTSNPQPEKAQWQNSKNGDDFYEMDVTKSKYFGSNV
SPECPRLVIPKTTFDDMLYYRLQISNKLGVNVSNIVYLKVTGSLPNITVGHETDINNRSI
KLRGVVFLSDDSPDIKNIFWSKNGEKLDIQGSGGRLSGVTIDDPSLTIRNVSQDDAGKYQ
LTAINAVGPNDSAVISIGSTVEEISESPEGAPRRKTPSKYKL
Download sequence
Identical sequences K1QFP7
EKC29919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]