SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC30339 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC30339
Domain Number 1 Region: 26-107
Classification Level Classification E-value
Superfamily HMG-box 2.88e-28
Family HMG-box 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC30339
Sequence length 339
Comment pep:novel supercontig:GCA_000297895.1:scaffold1094:141551:142570:1 gene:CGI_10021811 transcript:EKC30339 description:"Putative transcription factor SOX-14 "
Sequence
MVPQNNTVFGSQSIDPNTHTPYTDATQCKKQSNHVKRPMNAFMVWSQLERRKISEVSPDM
HNAEISKRLGKRWKTLNETDRQPFIEEAERLRLLHMQEYPDYKYRPRKKAKPVTKSESKV
SKPTSKTRTDRMKQKAAVRNFLDGATEPDSNVSTPYNSRLKLKLTIDKKFKDSIKASRHV
PVSSCQLTPPAKVPSSPSVYSPPTPESTSFYPEEIYDTPAASPEDIKCRPSNISSQGNPT
QQGDGSSLADLDNLTDVLQMPNNWQIELGNLDLSKLADTCDFPNFDLHNNNSNVSSACST
SSNGSHFEFPDYSTPEVSEMIGLESEWLDISVLGSIAAH
Download sequence
Identical sequences K1QGS2
XP_011445203.1.10878 EKC30339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]