SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC30508 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC30508
Domain Number 1 Region: 224-366
Classification Level Classification E-value
Superfamily PH domain-like 4e-33
Family Third domain of FERM 0.0000474
Further Details:      
 
Domain Number 2 Region: 118-225
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-29
Family Second domain of FERM 0.0000212
Further Details:      
 
Domain Number 3 Region: 37-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.67e-21
Family First domain of FERM 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC30508
Sequence length 2259
Comment pep:novel supercontig:GCA_000297895.1:scaffold1080:304734:334974:-1 gene:CGI_10012680 transcript:EKC30508 description:"Band 4.1-like protein 3 "
Sequence
MSCSDWIALCSLGNVNLAKMGENRGRITQVRTARSVICRILLLDGKLFEIDVDKRAVGQI
LFDKVCEHLDLIEKDYYGLSFTGLHTGLREWLNVEKKISKQMKGLAWEFKFEVKFYPPDP
QTLHEDLTRYQLCLQIRNDIVNEKLPCSAVTYALLGSYTVQSELGDFDIDEFGPGTEYIR
KMRFAPHQDRELLKKIAELHRTHKGQTPEAAELHFLENAKKLAMYGVDLSNAKDGENVDI
QLGVCWSGILVFREKLQINKFVWPKILKMSYRRKKFYIKLRTGEFEEFQSLIGFKFMSSR
HAKRMWKICVENHAFFRNREPDSPGTQRGLLRLGSKFRYSGRTHFQTKQAMMGVDRPSPF
FDRVHSRATYHGRTKNKDLHDEMFKPRPEPRHIPEYNREEKMMKKVPEPEIHNREPEDVF
DDDEDEEEGPDNRKSRMERMHAVPTPLAAVMKKDAPVNNNLEHHHRRRRSFEEADDREGV
EDDMVRTDRLYNLEYTHANTNSGNMWTVKDTNQKSSSHSSLTKPNLKRQRGRQRTGSENF
KKVSFDEESLRSASSQFSRSDSELWPQKLSVPKGRYLKKRTSSQSSMDSPLNVQSTMTST
PRNPLQYNQKVRRNLKESDFNSSVDEGFSDTFERNASGRKNDSNISCANSSKSGSFDRSP
ELTDGNTEMDKAHRSSESTQGQISFGGSLYRYSSSESDDDHRADVKIEEKKVNSTRQKGR
RDRQKAQADVKSPPARVSLEKSGFVIQDLDSEPGHRQLGTKSLSKNYRIAPSEKAMERRA
FYNKSPGNSEDSFSYKNNEAILLEKYIIRKPDSEASKSPRDQKPLDDSILRSNLKDPPEE
MELHDSFEYYGFAAGPQSTSSTGNILNESEVDSYHCDLVNEKRVVEEILYEDPSIKTELT
KTTAHGTAEDEHDGNRNGMEDGRDAWTNSTASILSLSSEEGSASVDDFLQEYDNEPCVRR
ARSVTLGGEVSAPTNPPSASKKVRFSSEDNLVYELRHGFSDEEKSSGSPQKLDFDFIDDC
HSDDQMSGSETSPPTPSLPRYFSDSDGSSSSCTPESSPRSPKNEAPLEESKTHRTLLQKS
LKMPAEKKISEVDWDEYTCKEGFHHEEGFSNDNSLKDKSYVSENPISRRSQVKNDVLNTY
KERISESDRVIEIEKEEICANKPCDDLTPLQSEKESHMMTERNVCRSLFKEAENSFEESS
KPSASHTKPTTSVEISRNILDAANASKDGNQISGLDHEDLETKIQQSHELKVEDDSKKNS
LLGKEACVPKTAFVHVSDKKQRQGIQTPISSCSVLPPSSSLPVRAASDSHSVSQNDPNFS
TPDSAPLTSDSGVCTLVQDDKRFTPTAAVAKQCVPGVLVQENNTSTNSSFATNVSPPVDQ
SYIDNQSQGNLSVSKPGESQRNSTFVSFQSSPVDKPYISYSMCAIVSTQGTTPSSQSYSN
STLGSSSSTLSPSTSTAASVCKPSQNSSGQSHSAFSDWNRKSAPVKPLTFIPPKKNVTIT
STQQNKSEKIMTPLASKSTLSPNVTHPKDTDSIKEPNSKQQLDECSKQDKDCQSGKQRQK
SSGNKYGSTAKWVLSHSERFLHGTDQLDKQEQQSTARNTTNRENRGADEHSSLKIDVADG
KGDTSIQEKRGADENFSGKVEAADGKGDTIIQEKRGADENFSGKVEAADGKGDTIIQEKR
GADENFSGKVEVAEGKGDRKVEQEGKEKNSKEDMKAPCLTNVMKKIEQEVGPEGSTKCAK
SEGEIGKEAEVQENTLIYKKENNTASVKDIGNSGSIWVKKDCQDTTMKLDIHQNNTTLDC
ESPSDISSKLQELNHDMSKGEKEQSSNHTRNTTDLVRSQREPGDFYVSRSYQMYPKEAMF
HNVSSRLYNENPKKKVYIDGSLQGTTRKMEAKKQEQQERGKDSVDGVHSVDSVHSVQNRE
TEGENAWKKDINFIKDSKQEVENIPIIAQRELASERQGKDYLDSSMMGRRGVTASKEEAE
SKGKLETNRNRKDLKTREAAPLCESESSDFEAELGLTEYSTDNHPETLIREKPREQEKST
KAASTSCGPKKTSQPEPPQSVRQKEGSRPEPQHSERSVDAPPTQQEPPSVHDLPSPPLDP
PELLSKEERKKREKEEKERKKKEKEEQKRKKKEEEKEKKRLAKEKKKKPAVEEKWQEAVA
VSATSETIVTMDRAPRRMSSFEEQKDDKPEPLEAEEQEVKRADRAEDSGSNRADQGSEEG
SDREGDPKDEQTQLTIRSLTFSVSNTLGNGPTERIVSCA
Download sequence
Identical sequences K1Q988
EKC30508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]