SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC31659 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC31659
Domain Number 1 Region: 14-93
Classification Level Classification E-value
Superfamily HMG-box 1.44e-27
Family HMG-box 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EKC31659
Sequence length 385
Comment pep:known supercontig:GCA_000297895.1:scaffold950:552822:556635:-1 gene:CGI_10022931 transcript:EKC31659 description:"Transcription factor Sox-8 "
Sequence
MPQRGPNGEKRKPHIKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNEEE
KRPFVDEAERLRVQHKKDYPDYKYQPRRRKPLKSANGNPADSAGGMSHAMMFKGMQGSPT
GMSDGDSSDCSSHNNHGPPTPPATPNQHELINLKSMADRMRAVRHISGGHQNSIDFSRVN
LELAPEAVAYNDLDEFDRYLPTTAANPAIQGENDQYTPYGMTSGTTSTSSSWTSSYRAPG
SMCLPNYNMTQNNDISTPYDLSNHRSPQSGNPSHSPNMHSPSYPSSASDCKYSDHEESNP
SVKLEPLSGRTQSSSQQYNYSLSPPPRYGMDGHHGNSYVSQGNNSYSSSSSSTGSQPYQF
MGMNRQMFNPIPAAVPADQQWDRYA
Download sequence
Identical sequences K1QKM6
EKC31659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]