SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC33169 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC33169
Domain Number 1 Region: 258-485
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.16e-59
Family Protein kinases, catalytic subunit 0.0000000494
Further Details:      
 
Domain Number 2 Region: 24-128
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000498
Family Pleckstrin-homology domain (PH domain) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC33169
Sequence length 605
Comment pep:novel supercontig:GCA_000297895.1:scaffold754:321153:352954:-1 gene:CGI_10014081 transcript:EKC33169 description:"RAC serine/threonine-protein kinase "
Sequence
MWIEKWDKCAAIGEATQGPKEVAPIVKEGYMFKRGEYIRNWRARYYILRADGVFHGFKSK
EEAQTSAEIQNDFMLQEDVTIVTQEKPKLNTFIVQGIILRGMQVDRIYYTETAEDREEWI
SAIQAVVDALGVGNWRSAFNELGEREEKMYDISLLNSSSKTLNDLPPNLIVRPLQLSDYD
KVVEDTAINRVISTATLVTELQFNQRSPMVGWIKDIVIDNIKGNQPQLKNVAHLKPRNIS
TDDVGVSFVEIVEEKRQSLDDFEFLKVLGKGTFGKVILCKEKTTNHLYAIKILKKQVIIA
KLENLLLDKDGHIKIADFGLCKEEMYYGASTKTFCGTPEYLAPEVLEDNDYGRAVDWWGT
GVVMYEMMCGRLPFYNRDHDILFELILLQQVKFPRTLSEDATSLLSGLLVKDPKQRLGGT
EDDVKVIVAHPFFKSINWQDLVEKKIPPPFMPQVTSETDTRYFDDTFTGESVELTPPPAP
AMPEFEASSHSLDRIDEDMAEVDTPYFEKFSYHGMSLIVMIQPPWKPDVKSSWDTKYIPD
EFAREITFLTPPGQEHLSESMRHELDSIDEEGELPYFEQFSFHGNSSKSFGGYLSESVRH
TDELF
Download sequence
Identical sequences K1QPW4
EKC33169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]