SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC33267 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC33267
Domain Number 1 Region: 22-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.44e-69
Family BAR domain 0.00055
Further Details:      
 
Domain Number 2 Region: 296-374
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000103
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC33267
Sequence length 375
Comment pep:novel supercontig:GCA_000297895.1:scaffold748:205091:222360:1 gene:CGI_10012647 transcript:EKC33267 description:"Endophilin-B1 "
Sequence
MDANTGLFKMKKFVSDASTVFNRAVQFTEEKLGSAEKTELDAHFENLLQRADKTKAWTEK
ILKQTESVLQPNPNIRMEDFVYEKLDKKKRDRVNHHEVLGHVLVDGGNDFGPGTTYGNAL
VKCGQAQLRIGNAEREFIQTTSNNFLQPLHNFLEGDMKTIQKEKKILETKRLDLDASKNR
LRKAKSTSQPQSSQNSPQNVLMMVEAEADLRVAQAEFDRQAEITKLLLEGVSSAHAHHLR
CLNDFIEAQLTYYAQCQNYISELQQQLGSYSHTSGVGNNSSNSSGAGISSGIPSSVPLQP
SAPPQINVIAATPNIEKKQARVLYDYDAADSSELTLLADELITVYKTPGLDPDWLMAERG
PQKGKVPTTYLEVLE
Download sequence
Identical sequences K1Q963
EKC33267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]