SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC37105 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC37105
Domain Number 1 Region: 12-57
Classification Level Classification E-value
Superfamily HMG-box 0.00000929
Family HMG-box 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC37105
Sequence length 715
Comment pep:novel supercontig:GCA_000297895.1:scaffold419:201465:204159:1 gene:CGI_10028332 transcript:EKC37105 description:""
Sequence
MEIEKCASQKISFKVFSNEQKSKMQTKYPFLCKSQINKKIKDLWKKLDNAEKSCYTKTIL
SPPKSKRVNKPQTKRAQAGAFSQRQSDSPYGRRFDKEKRKDKSLLSNLQQNQIRKEDGRH
SRNRFTEKRKLGEGSPKDVGAKSCKKTVPWKGRPSLGKEDLWSDSSSPERVGGKVAKPTK
RQKKVQGILKPSGDASRQLKTKNRVSFGSPQNKVPSKTSSPGNFGDLNNTASSDEDDNRA
RLLHRTDDDMYDFERIARYDLCVEEEDMYVTMFQQNPDLITNQHLSKTDNQQQSENETDF
KIPKNIISKRKRKNEERDEDKRDQGKNLLSPLTEESSQNSPSDITTPNVKHTLTNSLITP
QMNESLMQRKLEEVKKAPQKAKAFSPKASSGTEPVRKSTRRSISSGTNKKSDVEKETSDS
ESLSVTPLTESLQSENESTASQCSQGDIEETAKVLCTKKKNLGNSNSLRNPEKSTLERNS
FADYKCKATNLEKKINPQQKRKRRGQHMVAEKPQDAYSTSSSSESSSSLKENLEKRHKMP
KLCKKDQTNIKPPLSANKPERQSRKEQREIEENSSPKPCKKSKKVKSPVGRMDADRLISE
SPNKIDSIQNSPMGESCLYFNDDLSNDSDNSSTVMDDRKQTNQVIMSAILRMQQAIQCQD
TTDTDASSPSLSGINEVCSFISFELLFKLTRYLDNLCNMMGEIMTNETRIQILNL
Download sequence
Identical sequences K1R7H0
EKC37105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]