SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC39217 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC39217
Domain Number 1 Region: 444-764
Classification Level Classification E-value
Superfamily DNase I-like 1.96e-49
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000798
Further Details:      
 
Domain Number 2 Region: 32-133
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-21
Family SH2 domain 0.00045
Further Details:      
 
Domain Number 3 Region: 987-1054
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000609
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC39217
Sequence length 1056
Comment pep:novel supercontig:GCA_000297895.1:scaffold279:224675:251136:1 gene:CGI_10012630 transcript:EKC39217 description:"Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2A "
Sequence
MVEKARRIVGVDQWSRANKPTLRQIHTKMSGNYFHRGISRLRAEELLLSAGEDGCFLVRD
SETLQGAYVLCLLYQSRVHQYRVLPGHDNQLSIQAEGGAPEPKYSDLNSLVADYMKKGDK
NGLAFGLKFPVPPDRGEEVDSEPESSPVWIYCGDESPLLSNQHSQFPLFRGDTTQHDDDY
QDNPNVVPPPPQNFGSNGFDPNPEEQKIKTTLLNNFTKIDRNSIDSDFFDTLRNYFEKGI
ETDVTAVKAGDSNLPEFQKLLEFAAKNLQKELDKFIKKVRTINDLLTVPETSSLSRSPSM
VDKVQETLRYFSVSLYDSLPFETQESDPLPESCTPLLSSLGKPHIPRSDFEVKVIRTGKQ
SKMTLSVDIPHGRLYAVKPSKESLDSNNIFTHERITQLVKSTKDNTRLDMLVLDEEKKKK
QTKFTFAFTSVHVRETFCQQIMQMKNMHSSAVDVDQISVFVGTWNMGDSQPMSSINSWLR
CNGTGKLRDPQVLGVIPHDMYVIGTQESALTEKDWVNFVKNHIKSCLRADVEMVEVCTLW
GIRLVVLVKKQLHQYINRIQHSTVRTGIANTLGNKGAVGISFYFKGTSFCFVNCHLTSGD
ERNERRNQNYRDIIKGLSLGQKHLGLFDVLNQFNHLFWLGDLNYRVEDNIGTILEKLENR
DIDYLLTKDQLKKSQREKKGFCGFSEEEISFMPTYRLPRSQIEYKYDWRKQKKTGERINA
PSWCDRVLWRSYPGTYIENLAYGCADKVLGSDHRPVFSSFNVGVTSDFVMNRNSLSSESL
IKIVFYQVVAQLRPLFGDEEYLGEQHILIAVRSRDSDNECYGECVVELKGKINVNKPQLF
EIQLLHQGEVTGKLSGQVHALTGTFAPRSSKKSYELVALDTEYIDPELMHADSPNIPPPD
CQPPVPTGTLISNPHATLTHVQSMPTVMSERQGIPISRPAADDLPNTSRMKSHPLPGMQS
SIRVGPSGGTVTEPPNKPPPPLPKKQPSYVNITKAHPVGEWLKSINLPQYQDNFLKNGFD
VLLNLKNMSKRDLKEIGISNVIHIDMMLESLKRISQ
Download sequence
Identical sequences K1QQH2
EKC39217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]