SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC40895 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC40895
Domain Number 1 Region: 22-206
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-43
Family DNA gyrase/MutL, N-terminal domain 0.0000385
Further Details:      
 
Domain Number 2 Region: 199-340
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.71e-21
Family DNA gyrase/MutL, second domain 0.0012
Further Details:      
 
Domain Number 3 Region: 609-659
Classification Level Classification E-value
Superfamily HMG-box 0.0000000458
Family HMG-box 0.0032
Further Details:      
 
Weak hits

Sequence:  EKC40895
Domain Number - Region: 767-937
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 0.00262
Family DNA mismatch repair protein MutL 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EKC40895
Sequence length 966
Comment pep:novel supercontig:GCA_000297895.1:scaffold150:511383:521169:-1 gene:CGI_10028611 transcript:EKC40895 description:"PMS1-like protein 1 "
Sequence
MTEPKRLLHELPKETVRLLGSSQVITSVFSVVKELIENSLDAGATSLELRLENYGLDKIE
LRDNGAGIPASDISFVAKKYHTSKITSFSDLEDLVTYGFRGEALGSLCNVSSLSITTRTK
EEEVSSTYSFNHQGQITSSRPSHLGIGTTITAVNLFKNLPVRRQFYNTNKKKKDELKRIE
DLLLSYGIVSPTVRISLRHNKDIIWQKNQVKDVKTAILETLGKDVSSSLQRKELSLEIPK
VAMELYLPSPGCDWTSVTRSTSDRGFVFVNHRPVQQKEVEKMIRSHLGLEKGRHPVFIAS
IVIPPSDLDVNVEPNKTRVFLHRQEAILELLESYLIEAYDQNKLSNKENHISLNTDPLPV
EKEAEESSPITKNIHNNSETEVNTDSLVKTEHRVKVITQGDTSLIDTSLPVFRITLEQEE
VQSESSAPSVVEDLPCLPMTLNQATAHEQETDNMFKQMCTDEKETTKSGVELVETTEHLD
MPIVPNIVVTPEVTMERLEVKSTAENDDLMEDSLSELLSSWPEKADSESVSSVSSERVSC
DNQSSIPSGEQWSRGQGLKSSSGKAIEPVTILNHGKRPLSPERGESPPHKRRSMEVTFDE
SRTFSTPGKENAFKLFAKITTPKVMTANPECSDSRVSEILMESWDNLSASEKTTYELKAG
AQSLEKGGHKSVANHSMKNKVQKSNVNTSGLSSTPSIKEQLMRNMNRPRKQQATPREEDQ
RIEKTLPFSISKLRKTFSSHPSESSLISSSSCWQLIGPLKSCGMWTCYHDYKIHILNPHR
VHETVLYHRLMNEHVLPSEALERPVKITQEVLGNLWEPFKNLAIQHNTTQMYSILQDRRF
TSNGIQIKLFFDAESEIQAELSALPACIPTYGIEDVKEILELIYSTGTDSVAGSRPLKVI
NYLKSEAVRMARQLPRQQDYDDMVDLLRQIEELLPKGCNSCLHDKLFLHAIFDLNNIPLT
QYSQEN
Download sequence
Identical sequences K1RHB9
XP_011427622.1.10878 EKC40895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]