SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EKC40933 from Crassostrea gigas 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EKC40933
Domain Number 1 Region: 296-479
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.45e-42
Family Ribonuclease PH domain 1-like 0.0000486
Further Details:      
 
Domain Number 2 Region: 10-140
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.8e-37
Family Ribonuclease PH domain 1-like 0.00011
Further Details:      
 
Domain Number 3 Region: 431-535
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-22
Family Ribonuclease PH domain 2-like 0.00024
Further Details:      
 
Domain Number 4 Region: 141-227
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.67e-21
Family Ribonuclease PH domain 2-like 0.0041
Further Details:      
 
Domain Number 5 Region: 226-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.7e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0014
Further Details:      
 
Domain Number 6 Region: 533-616
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000136
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EKC40933
Sequence length 668
Comment pep:novel supercontig:GCA_000297895.1:scaffold150:1128219:1141761:-1 gene:CGI_10028653 transcript:EKC40933 description:"Polyribonucleotide nucleotidyltransferase 1, mitochondrial "
Sequence
MPNNLLKPIDRDLTIETGKLAKFADGAAVIKQGETSVLVTVVSKSLSQPSSFLPLTVDYR
LKAAAAGRIPMNYFRRERGPTDNEILTSRVIDRSIRPLFPEDCQRELQVMCNVLAVDGEN
DPAVLSINAASCATALSLMPWNGPVGAVRVGYIDGKIVINPQRHELEKSDINLIVASSLQ
GVVMLEGGANIVSYDLMKQAINTGHIENMKIIQSIQQMTENSTKAKSTPREVQDELWKTV
YNVCSKAFYPIFNDHTHDKFSRDAKVKTEIEKATKVLLEIYPNVDRELLNSYIQKCFKEV
FRKNIFKTDKRCDGRGLSDLRNISCSVDVLKPLHGSSLFQRGQTQVIGQESGVKEKNFML
HYEFPPYATNEIGRPGAALARREIGHGALAERGLRPIIPDNLPFSLRVTSEVLESNGSSS
MASVCGGSLALMDAGVPVKEAAAGVAIGLMTKINYQGETIDHRILTDLLGIEDYCGDMDF
KMAGTRNGITAIQADIKIEGLPLKIVSKAIDAGKSGIVRILDIMDTVIKTPRQDKKNSPV
KETFVINPKKRGRIMGFGGSKIRELAQKTGVQMSPVDDSVFELFAPDSSAMEEGKALLNS
WLEEKPAPDMEFGAIYTVKILEVEDARLLGFKPGDEIQVKYFGNDPTSGQVRLSRRLLLS
PSVSAFKS
Download sequence
Identical sequences K1R5C2
EKC40933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]